Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Mouse anti-Human CSK Monoclonal Antibody | anti-CSK antibody

CSK (Tyrosine-protein Kinase CSK, C-SRC Kinase, Protein-tyrosine Kinase CYL) (Biotin)

Reactivity
Human
Applications
ELISA, Immunohistochemistry, Immunoprecipitation, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CSK; Monoclonal Antibody; CSK (Tyrosine-protein Kinase CSK; C-SRC Kinase; Protein-tyrosine Kinase CYL) (Biotin); anti-CSK antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3A3
Specificity
Recognizes human CSK.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-CSK antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Immunoprecipitation (IP), Western Blot (WB)
Application Notes
IHC-P: 1ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-100 from human CSK (NP_004374) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MSAIQAAWPSGTECIAKYNFHGTAEQDLPFCKGDVLTIVAVTKDPNWYKAKNKVGREGIIPANYVQKREGVKAGTKLSLMPWFHGKITREQAERLLYPPE
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to CSK on formalin-fixed paraffin-embedded human colon. [antibody concentration 1ug/ml].)

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to CSK on formalin-fixed paraffin-embedded human colon. [antibody concentration 1ug/ml].)

Immunoprecipitation (IP)

(Immunoprecipitation of CSK transfected lysate using CSK monoclonal antibody and Protein A Magnetic Bead and immunoblotted with CSK rabbit polyclonal antibody.)

Immunoprecipitation (IP) (Immunoprecipitation of CSK transfected lysate using CSK monoclonal antibody and Protein A Magnetic Bead and immunoblotted with CSK rabbit polyclonal antibody.)

Testing Data

(Detection limit for recombinant GST tagged CSK is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged CSK is ~0.1ng/ml as a capture antibody.)

Western Blot (WB)

(Western blot analysis of CSK over-expressed 293 cell line, cotransfected with CSK Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with CSK monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Western Blot (WB) (Western blot analysis of CSK over-expressed 293 cell line, cotransfected with CSK Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with CSK monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Western Blot (WB)

(Western Blot analysis of CSK expression in transfected 293T cell line by CSK monoclonal antibody. Lane 1: CSK transfected lysate (50.7kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of CSK expression in transfected 293T cell line by CSK monoclonal antibody. Lane 1: CSK transfected lysate (50.7kD). Lane 2: Non-transfected lysate.)

Western Blot (WB)

(CSK monoclonal antibody. Western Blot analysis of CSK expression in Hela NE.)

Western Blot (WB) (CSK monoclonal antibody. Western Blot analysis of CSK expression in Hela NE.)
Product Categories/Family for anti-CSK antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
51kDa
NCBI Official Full Name
tyrosine-protein kinase CSK
NCBI Official Synonym Full Names
C-terminal Src kinase
NCBI Official Symbol
CSK
NCBI Protein Information
tyrosine-protein kinase CSK
UniProt Protein Name
Tyrosine-protein kinase CSK
Protein Family
UniProt Gene Name
CSK
UniProt Entry Name
CSK_HUMAN

NCBI Description

The protein encoded by this gene is involved in multiple pathways, including the regulation of Src family kinases. It plays an important role in T-cell activation through its association with the protein encoded by the protein tyrosine phosphatase, non-receptor type 22 (PTPN22) gene. This protein also phosphorylates C-terminal tyrosine residues on multiple substrates, including the protein encoded by the SRC proto-oncogene, non-receptor tyrosine kinase gene. Phosphorylation suppresses the kinase activity of the Src family tyrosine kinases. An intronic polymorphism (rs34933034) in this gene has been found to affect B-cell activation and is associated with systemic lupus erythematosus (SLE). Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2017]

Uniprot Description

CSK: a tyrosine kinase of the Csk family that phosphorylates and inhibits Src family kinases. Specifically phosphorylates Y504 on LCK, which acts as a negative regulatory site. Csk and the phospho-tyrosine phosphatase CD45 reciprocally regulate phosphorylation of the inhibitory tyrosine of the Src family kinases Lck and Fyn during T-cell receptor mediated signaling during thymic development.

Protein type: Protein kinase, TK; EC 2.7.10.2; Kinase, protein; Protein kinase, tyrosine (non-receptor); TK group; Csk family

Chromosomal Location of Human Ortholog: 15q24.1

Cellular Component: extrinsic to internal side of plasma membrane; cytoplasm; plasma membrane; intercellular junction; cytosol; lipid raft

Molecular Function: protein C-terminus binding; identical protein binding; protein binding; protein-tyrosine kinase activity; non-membrane spanning protein tyrosine kinase activity; protein phosphatase binding; ATP binding; receptor binding

Biological Process: epidermal growth factor receptor signaling pathway; platelet activation; negative regulation of kinase activity; negative regulation of phagocytosis; cell migration; central nervous system development; negative regulation of Golgi to plasma membrane protein transport; protein amino acid phosphorylation; T cell receptor signaling pathway; regulation of cytokine production; regulation of cell proliferation; positive regulation of MAP kinase activity; negative regulation of cell proliferation; T cell costimulation; negative regulation of interleukin-6 production; innate immune response; oligodendrocyte differentiation; morphogenesis of an epithelium; brain development; negative regulation of bone resorption; cell differentiation; blood coagulation; transmembrane receptor protein tyrosine kinase signaling pathway

Research Articles on CSK

Similar Products

Product Notes

The CSK csk (Catalog #AAA6141378) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CSK (Tyrosine-protein Kinase CSK, C-SRC Kinase, Protein-tyrosine Kinase CYL) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CSK can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Immunoprecipitation (IP), Western Blot (WB). IHC-P: 1ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CSK csk for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CSK, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.