Mouse CSF1R Monoclonal Antibody | anti-CSF1R antibody

CSF1R (Colony Stimulating Factor 1 Receptor, C-Fms, CD115, CSFR, FIM2, Fms) (MaxLight 750)

Cat. Num. AAA6237776

• Gene Names: CSF1R; FMS; CSFR; FIM2; HDLS; C-FMS; CD115; CSF-1R; BANDDOS; M-CSF-R
• Applications: Western Blot
• Purity: Purified
• Synonyms: CSF1R; Monoclonal Antibody; CSF1R (Colony Stimulating Factor 1 Receptor; C-Fms; CD115; CSFR; FIM2; Fms) (MaxLight 750); Colony Stimulating Factor 1 Receptor; Fms; anti-CSF1R antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 3G12
• Specificity: Recognizes CSF1R.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight750.
• Sequence Length: 972

• Applicable Applications for anti-CSF1R antibody: Western Blot (WB), In situ Proximity Ligation Assay (Cell)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: CSF1R (AAH47521, 21aa-120aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: PVIEPSVPELVVKPGATVTLRCVGNGSVEWDGPPSPHWTLYSDGSSSILSTNNATFQNTGTYRCTEPGDPLGGSAAIHLYVKDPARPWNVLAQEVVVFED
• Conjugate: MaxLight750
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight750 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Related Product Information for anti-CSF1R antibody

The protein encoded by this gene is the receptor for colony stimulating factor 1, a cytokine which controls the production, differentiation, and function of macrophages. This receptor mediates most if not all of the biological effects of this cytokine. Ligand binding activates the receptor kinase through a process of oligomerization and transphosphorylation. The encoded protein is a tyrosine kinase transmembrane receptor and member of the CSF1/PDGF receptor family of tyrosine-protein kinases. Mutations in this gene have been associated with a predisposition to myeloid malignancy. The first intron of this gene contains a transcriptionally inactive ribosomal protein L7 processed pseudogene oriented in the opposite direction. [provided by RefSeq]

Product Categories/Family for anti-CSF1R antibody

Antibodies; Growth Factors; Cytokines

NCBI and Uniprot Product Information

• NCBI GI #: 28833091
• NCBI GeneID: 1436
• NCBI Official Full Name: Colony stimulating factor 1 receptor
• NCBI Official Synonym Full Names: colony stimulating factor 1 receptor
• NCBI Official Symbol: CSF1R
• NCBI Official Synonym Symbols: FMS; CSFR; FIM2; HDLS; C-FMS; CD115; CSF-1R; BANDDOS; M-CSF-R
• NCBI Protein Information: macrophage colony-stimulating factor 1 receptor
• Protein Family: Macrophage colony-stimulating factor 1 receptor

NCBI Description

The protein encoded by this gene is the receptor for colony stimulating factor 1, a cytokine which controls the production, differentiation, and function of macrophages. This receptor mediates most if not all of the biological effects of this cytokine. Ligand binding activates the receptor kinase through a process of oligomerization and transphosphorylation. The encoded protein is a tyrosine kinase transmembrane receptor and member of the CSF1/PDGF receptor family of tyrosine-protein kinases. Mutations in this gene have been associated with a predisposition to myeloid malignancy. The first intron of this gene contains a transcriptionally inactive ribosomal protein L7 processed pseudogene oriented in the opposite direction. Alternative splicing results in multiple transcript variants. Expression of a splice variant from an LTR promoter has been found in Hodgkin lymphoma (HL), HL cell lines and anaplastic large cell lymphoma. [provided by RefSeq, Mar 2017]