Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Immunoperoxidase of monoclonal antibody to CSE1L on formalin-fixed paraffin-embedded human prostate. [antibody concentration 3 ug/ml])

Mouse CSE1L Monoclonal Antibody | anti-CSE1L antibody

CSE1L (CSE1 Chromosome Segregation 1-like (yeast), CAS, CSE1, MGC117283, MGC130036, MGC130037, XPO2) (FITC)

Gene Names
CSE1L; CAS; CSE1; XPO2
Applications
Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Purified
Synonyms
CSE1L; Monoclonal Antibody; CSE1L (CSE1 Chromosome Segregation 1-like (yeast); CAS; CSE1; MGC117283; MGC130036; MGC130037; XPO2) (FITC); CSE1 Chromosome Segregation 1-like (yeast); XPO2; anti-CSE1L antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3D8
Specificity
Recognizes CSE1L.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-CSE1L antibody
Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
CSE1L (NP_001307, 872aa-971aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LIGLFELPEDDTIPDEEHFIDIEDTPGYQTAFSQLAFAGKKEHDPVGQMVNNPKIHLAQSLHKLSTACPGRVPSMVSTSLNAEALQYLQGYLQAARVTLL
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.

FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Immunoperoxidase of monoclonal antibody to CSE1L on formalin-fixed paraffin-embedded human prostate. [antibody concentration 3 ug/ml])

Testing Data (Immunoperoxidase of monoclonal antibody to CSE1L on formalin-fixed paraffin-embedded human prostate. [antibody concentration 3 ug/ml])

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to CSE1L on formalin-fixed paraffin-embedded human prostate. [antibody concentration 3 ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to CSE1L on formalin-fixed paraffin-embedded human prostate. [antibody concentration 3 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to CSE1L on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to CSE1L on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to CSE1L on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to CSE1L on HeLa cell. [antibody concentration 10 ug/ml])

Western Blot (WB)

(CSE1L monoclonal antibody (M08), clone 3D8 Western Blot analysis of CSE1L expression in Hela S3 NE (Cat # L013V3).)

Western Blot (WB) (CSE1L monoclonal antibody (M08), clone 3D8 Western Blot analysis of CSE1L expression in Hela S3 NE (Cat # L013V3).)

Testing Data

(Detection limit for recombinant GST tagged CSE1L is approximately 3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged CSE1L is approximately 3ng/ml as a capture antibody.)
Related Product Information for anti-CSE1L antibody
Proteins that carry a nuclear localization signal (NLS) are transported into the nucleus by the importin-alpha/beta heterodimer. Importin-alpha binds the NLS, while importin-beta mediates translocation through the nuclear pore complex. After translocation, RanGTP binds importin-beta and displaces importin-alpha. Importin-alpha must then be returned to the cytoplasm, leaving the NLS protein behind. The protein encoded by this gene binds strongly to NLS-free importin-alpha, and this binding is released in the cytoplasm by the combined action of RANBP1 and RANGAP1. In addition, the encoded protein may play a role both in apoptosis and in cell proliferation. [provided by RefSeq]
Product Categories/Family for anti-CSE1L antibody
References
1. CSE1L modulates Ras-induced cancer cell invasion: correlation of K-Ras mutation and CSE1L expression in colorectal cancer progression.Jiang MC, Yeh CM, Tai CJ, Chen HC, Lin SH, Su TC, Shen SC, Lee WR, Liao CF, Li LT, Lee CH, Chen YC, Yeh KT, Chang CCAm J Surg. 2013 Jun 24. pii: S0002-9610(13)00247-X. doi: 10.1016/j.amjsurg.2012.11. 021. 2.MIR-137 Suppresses Growth and Invasion, is Downregulated in Oligodendroglial Tumors and Targets CSE1L.Li KK, Yang L, Pang JC, Chan AK, Zhou L, Mao Y, Wang Y, Lau KM, Poon WS, Shi Z, Ng HK.Brain Pathol. 2012 Dec 17. doi: 10.1111/bpa.12015. 3.The prognostic significance of nuclear CSE1L in urinary bladder urothelial carcinomas.Chang CC, Tai CJ, Su TC, Shen KH, Lin SH, Yeh CM, Yeh KT, Lin YM, Jiang MC.Ann Diagn Pathol. 2012 Apr 2. 4. Differential distributions of CSE1L/CAS and E-cadherin in the polarized and non-polarized epithelial glands of neoplastic colorectal epithelium.Uen WC, Tai CJ, Shen SC, Lee WR, Tsao TY, Deng WP, Chiou HY, Hsu CH, Hsieh CI, Liao CF, Jiang MC.J Mol Histol. 2010 Aug 24. 5. Serum Cellular Apoptosis Susceptibility Protein Is a Potential Prognostic Marker for Metastatic Colorectal Cancer.Stella Tsai CS, Chen HC, Tung JN, Tsou SS, Tsao TY, Liao CF, Chen YC, Yeh CY, Yeh KT, Jiang MC.Am J Pathol. 2010 Apr;176(4):1619-28. Epub 2010 Feb 11. 6. Higher Prevalence of Secretory CSE1L/CAS in Sera of Patients with Metastatic Cancer.Tung MC, Tsai CS, Tung JN, Tsao TY, Chen HC, Yeh KT, Liao CF, Jiang MC.Cancer Epidemiol Biomarkers Prev. 2009 May;18(5):1570-7. Epub 2009 Apr 21. 7.Function of CSE1L/CAS in the secretion of HT-29 human colorectal cells and its expression in human colon. Tsao TY, Tsai CS, Tung JN, Chen SL, Yue CH, Liao CF, Wang CC, Jiang MC.Mol Cell Biochem. 2009 Jul;327(1-2):163-70. Epub 2009 Feb 18.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
103,879 Da
NCBI Official Full Name
exportin-2 isoform 1
NCBI Official Synonym Full Names
CSE1 chromosome segregation 1-like (yeast)
NCBI Official Symbol
CSE1L
NCBI Official Synonym Symbols
CAS; CSE1; XPO2
NCBI Protein Information
exportin-2; cellular apoptosis susceptibility protein; chromosome segregation 1-like protein; exp2; importin-alpha re-exporter
UniProt Protein Name
Exportin-2
UniProt Gene Name
CSE1L
UniProt Synonym Gene Names
CAS; XPO2; Exp2
UniProt Entry Name
XPO2_HUMAN

Uniprot Description

Exportin-2: Export receptor for importin-alpha. Mediates importin- alpha re-export from the nucleus to the cytoplasm after import substrates (cargos) have been released into the nucleoplasm. In the nucleus binds cooperatively to importin-alpha and to the GTPase Ran in its active GTP-bound form. Docking of this trimeric complex to the nuclear pore complex (NPC) is mediated through binding to nucleoporins. Upon transit of a nuclear export complex into the cytoplasm, disassembling of the complex and hydrolysis of Ran-GTP to Ran-GDP (induced by RANBP1 and RANGAP1, respectively) cause release of the importin-alpha from the export receptor. CSE1L/XPO2 then return to the nuclear compartment and mediate another round of transport. The directionality of nuclear export is thought to be conferred by an asymmetric distribution of the GTP- and GDP-bound forms of Ran between the cytoplasm and nucleus. Belongs to the XPO2/CSE1 family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Nuclear import; Karyopherin; Nuclear export

Chromosomal Location of Human Ortholog: 20q13

Cellular Component: nucleoplasm; membrane; cytoplasm; nucleus

Molecular Function: protein binding; importin-alpha export receptor activity; Ran GTPase binding

Biological Process: cell proliferation; apoptosis; protein export from nucleus

Similar Products

Product Notes

The CSE1L cse1l (Catalog #AAA6175295) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's CSE1L can be used in a range of immunoassay formats including, but not limited to, Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CSE1L cse1l for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CSE1L, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.