Mouse anti-Human CRYM Monoclonal Antibody | anti-CRYM antibody

CRYM (Thiomorpholine-carboxylate Dehydrogenase, Mu-crystallin Homolog, NADP-regulated Thyroid-hormone-binding Protein, Ketimine Reductase, THBP) (Biotin)

Cat. Num. AAA6141374

• Gene Names: CRYM; THBP; DFNA40
• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Immunoprecipitation, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: CRYM; Monoclonal Antibody; CRYM (Thiomorpholine-carboxylate Dehydrogenase; Mu-crystallin Homolog; NADP-regulated Thyroid-hormone-binding Protein; Ketimine Reductase; THBP) (Biotin); anti-CRYM antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 6B3
• Specificity: Recognizes human CRYM.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-CRYM antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Immunoprecipitation (IP), Western Blot (WB)
• Application Notes: IHC-P: 3ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa215-314 from human CRYM (NP_001879) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: EWVKPGAHINAVGASRPDWRELDDELMKEAVLYVDSQEAALKESGDVLLSGAEIFAELGEVIKGVKPAHCEKTTVFKSLGMAVEDTVAAKLIYDSWSSGK
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB)

(Western Blot analysis of CRYM expression in transfected 293T cell line by CRYM monoclonal antibody. Lane 1: CRYM transfected lysate (33.8kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to CRYM on formalin-fixed paraffin-embedded human skeletal muscle. [antibody concentration 3ug/ml].)

Immunoprecipitation (IP)

(Immunoprecipitation of CRYM transfected lysate using CRYM monoclonal antibody and Protein A Magnetic Bead and immunoblotted with CRYM rabbit polyclonal antibody.)

Testing Data

(Detection limit for recombinant GST tagged CRYM is ~0.03ng/ml as a capture antibody.)

Western Blot (WB)

(CRYM monoclonal antibody, Western Blot analysis of CRYM expression in Jurkat.)

Product Categories/Family for anti-CRYM antibody

Antibodies; Enzymes; Dehydrogenase

References

1. The FSHD Atrophic Myotube Phenotype Is Caused by DUX4 Expression. Vanderplanck C, Ansseau E, Charron S, Stricwant N, Tassin A, Laoudj-Chenivesse D, Wilton SD, Coppee F, Belayew A.PLoS One. 2011;6(10):e26820. Epub 2011 Oct 28. 2. Proteomic Analysis Illuminates a Novel Structural Definition of the Claustrum and Insula. Mathur BN, Caprioli RM, Deutch AY.Cereb Cortex. 2009 Oct;19(10):2372-9. Epub 2009 Jan 23. 3. Abnormal expression of mu-crystallin in facioscapulohumeral muscular dystrophy. Reed PW, Corse AM, Porter NC, Flanigan KM, Bloch RJ.Exp Neurol. 2007 Jun;205(2):583-6. Epub 2007 Mar 21.

NCBI and Uniprot Product Information

• NCBI GI #: 4503065
• NCBI GeneID: 1428
• NCBI Accession #: NP_001879
• NCBI GenBank Nucleotide #: NM_001888
• UniProt Accession #: Q14894; Q5HYB7; D5MNX0
• Molecular Weight: 35.9 kDa (334aa), confirmed by MALDI-TOF
• NCBI Official Full Name: ketimine reductase mu-crystallin
• NCBI Official Synonym Full Names: crystallin mu
• NCBI Official Symbol: CRYM
• NCBI Official Synonym Symbols: THBP; DFNA40
• NCBI Protein Information: ketimine reductase mu-crystallin
• UniProt Protein Name: Ketimine reductase mu-crystallin
• Protein Family: Ketimine reductase
• UniProt Gene Name: CRYM
• UniProt Synonym Gene Names: THBP
• UniProt Entry Name: CRYM_HUMAN

NCBI Description

Crystallins are separated into two classes: taxon-specific and ubiquitous. The former class is also called phylogenetically-restricted crystallins. The latter class constitutes the major proteins of vertebrate eye lens and maintains the transparency and refractive index of the lens. This gene encodes a taxon-specific crystallin protein that binds NADPH and has sequence similarity to bacterial ornithine cyclodeaminases. The encoded protein does not perform a structural role in lens tissue, and instead it binds thyroid hormone for possible regulatory or developmental roles. Mutations in this gene have been associated with autosomal dominant non-syndromic deafness. [provided by RefSeq, Sep 2014]

Uniprot Description

CRYM: Specifically catalyzes the reduction of imine bonds in brain substrates that may include cystathionine ketimine (CysK) and lanthionine ketimine (LK). Binds thyroid hormone which is a strong reversible inhibitor. Presumably involved in the regulation of the free intracellular concentration of triiodothyronine and access to its nuclear receptors. Belongs to the ornithine cyclodeaminase family.

Protein type: Lyase; EC 1.5.1.25

Chromosomal Location of Human Ortholog: 16p12.2

Cellular Component: mitochondrion; cytoplasm; nucleus

Molecular Function: thiomorpholine-carboxylate dehydrogenase activity; protein homodimerization activity; NADP binding; transcription corepressor activity

Biological Process: sensory perception of sound; negative regulation of transcription from RNA polymerase II promoter; thyroid hormone metabolic process

Disease: Deafness, Autosomal Dominant 40