Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human CRYGC Monoclonal Antibody | anti-CRYGC antibody

CRYGC (Gamma-crystallin C, Gamma-C-crystallin, Gamma-crystallin 2-1, Gamma-crystallin 3, CRYG3) (MaxLight 550)

Gene Names
CRYGC; CCL; CRYG3; CTRCT2
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CRYGC; Monoclonal Antibody; CRYGC (Gamma-crystallin C; Gamma-C-crystallin; Gamma-crystallin 2-1; Gamma-crystallin 3; CRYG3) (MaxLight 550); anti-CRYGC antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
7C4
Specificity
Recognizes human CRYGC.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight550.
Applicable Applications for anti-CRYGC antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa75-174 from human CRYGC (NP_066269) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SIRSCCLIPQTVSHRLRLYEREDHKGLMMELSEDCPSIQDRFHLSEIRSLHVLEGCWVLYELPNYRGRQYLLRPQEYRRCQDWGAMDAKAGSLRRVVDLY
Conjugate
MaxLight550
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-CRYGC antibody
Crystallins are the dominant structural components of the vertebrate eye lens.
Product Categories/Family for anti-CRYGC antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
23.5kDa (198aa), confirmed by MALDI-TOF
NCBI Official Full Name
gamma-crystallin C
NCBI Official Synonym Full Names
crystallin gamma C
NCBI Official Symbol
CRYGC
NCBI Official Synonym Symbols
CCL; CRYG3; CTRCT2
NCBI Protein Information
gamma-crystallin C
UniProt Protein Name
Gamma-crystallin C
Protein Family
UniProt Gene Name
CRYGC
UniProt Synonym Gene Names
CRYG3
UniProt Entry Name
CRGC_HUMAN

NCBI Description

This gene encodes a member of the beta/gamma-crystallin family of proteins. Crystallins constitute the major proteins of vertebrate eye lens and maintain the transparency and refractive index of the lens. This gene and several family members are present in a gene cluster on chromosome 2. Mutations in this gene have been shown to cause multiple types of cataract, including Coppock-like cataract and zonular pulverulent cataract, among others. [provided by RefSeq, Jan 2015]

Uniprot Description

CRYGC: a major structural protein of the eye lens. A member of the beta/gamma-crystallin family. Gamma-crystallins are a homogeneous group of highly symmetrical, monomeric proteins typically lacking connecting peptides and terminal extensions. Gamma-crystallins are involved in cataract formation.

Protein type: Cytoskeletal

Chromosomal Location of Human Ortholog: 2q33.3

Cellular Component: cytoplasm; nucleus

Molecular Function: protein binding; structural constituent of eye lens

Biological Process: camera-type eye development; visual perception

Disease: Cataract 2, Multiple Types

Research Articles on CRYGC

Similar Products

Product Notes

The CRYGC crygc (Catalog #AAA6210979) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CRYGC (Gamma-crystallin C, Gamma-C-crystallin, Gamma-crystallin 2-1, Gamma-crystallin 3, CRYG3) (MaxLight 550) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CRYGC can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CRYGC crygc for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CRYGC, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.