Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged CRYBB2 is 3 ng/ml as a capture antibody.)

Mouse CRYBB2 Monoclonal Antibody | anti-CRYBB2 antibody

CRYBB2 (Crystallin, beta B2, CCA2, CRYB2, CRYB2A, D22S665) (APC)

Gene Names
CRYBB2; CCA2; CRYB2; CRYB2A; CTRCT3; D22S665
Applications
Western Blot
Purity
Purified
Synonyms
CRYBB2; Monoclonal Antibody; CRYBB2 (Crystallin; beta B2; CCA2; CRYB2; CRYB2A; D22S665) (APC); Crystallin; D22S665; anti-CRYBB2 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1F1
Specificity
Recognizes CRYBB2.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-CRYBB2 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
CRYBB2 (NP_000487.1, 1aa-205aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MASDHQTQAGKPQSLNPKIIIFEQENFQGHSHELNGPCPNLKETGVEKAGSVLVQAGPWVGYEQANCKGEQFVFEKGEYPRWDSWTSSRRTDSLSSLRPIKVDSQEHKIILYENPNFTGKKMEIIDDDVPSFHAHGYQEKVSSVRVQSGTWVGYQYPGYRGLQYLLEKGDYKDSSDFGAPHPQVQSVRRIRDMQWHQRGAFHPSN
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged CRYBB2 is 3 ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged CRYBB2 is 3 ng/ml as a capture antibody.)

Western Blot (WB)

(Western Blot analysis of CRYBB2 expression in transfected 293T cell line by CRYBB2 monoclonal antibody (M02), clone 1F1.Lane 1: CRYBB2 transfected lysate (Predicted MW: 23.4 KDa).Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of CRYBB2 expression in transfected 293T cell line by CRYBB2 monoclonal antibody (M02), clone 1F1.Lane 1: CRYBB2 transfected lysate (Predicted MW: 23.4 KDa).Lane 2: Non-transfected lysate.)
Product Categories/Family for anti-CRYBB2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
23,380 Da
NCBI Official Full Name
beta-crystallin B2
NCBI Official Synonym Full Names
crystallin, beta B2
NCBI Official Symbol
CRYBB2
NCBI Official Synonym Symbols
CCA2; CRYB2; CRYB2A; CTRCT3; D22S665
NCBI Protein Information
beta-crystallin B2; beta-B2 crystallin; beta-crystallin Bp; eye lens structural protein
UniProt Protein Name
Beta-crystallin B2
Protein Family
UniProt Gene Name
CRYBB2
UniProt Synonym Gene Names
CRYB2; CRYB2A
UniProt Entry Name
CRBB2_HUMAN

Uniprot Description

CRYBB2: a major structural protein of the eye lens. A member of the beta/gamma-crystallin family. Defects are the cause of congenital cerulean type 2 cataract, sutural cataract with punctate and cerulean opacities, and Coppock-like cataract.

Chromosomal Location of Human Ortholog: 22q11.23

Molecular Function: identical protein binding; protein homodimerization activity; structural constituent of eye lens; structural molecule activity

Biological Process: camera-type eye development; response to stimulus; visual perception

Disease: Cataract 3, Multiple Types

Similar Products

Product Notes

The CRYBB2 crybb2 (Catalog #AAA6169933) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's CRYBB2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CRYBB2 crybb2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CRYBB2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.