Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.89kD).)

Mouse CROT Monoclonal Antibody | anti-CROT antibody

CROT (Peroxisomal Carnitine O-Octanoyltransferase, COT) APC

Gene Names
CROT; COT
Reactivity
Human, Mouse, Rat
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CROT; Monoclonal Antibody; CROT (Peroxisomal Carnitine O-Octanoyltransferase; COT) APC; anti-CROT antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse, Rat
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1A6
Specificity
Recognizes human CROT. Species Crossreactivity: mouse and rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-CROT antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa2-100 from human CROT (NP_066974) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
ENQLAKSTEERTFQYQDSLPSLPVPSLEESLKKYLESVKPFANQEEYKKTEEIVQKFQSGIGEKLHQKLLERAKGKRNWLEEWWLNVAYLDVRIPSQL
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.89kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.89kD).)

Western Blot (WB)

(CROT monoclonal antibody, Western Blot analysis of CROT expression in HeLa.)

Western Blot (WB) (CROT monoclonal antibody, Western Blot analysis of CROT expression in HeLa.)

Western Blot (WB)

(CROT monoclonal antibody. Western Blot analysis of CROT expression in PC-12.)

Western Blot (WB) (CROT monoclonal antibody. Western Blot analysis of CROT expression in PC-12.)

Western Blot (WB)

(CROT monoclonal antibody. Western Blot analysis of CROT expression in Raw 264.7.)

Western Blot (WB) (CROT monoclonal antibody. Western Blot analysis of CROT expression in Raw 264.7.)

Western Blot (WB)

(CROT monoclonal antibody. Western Blot analysis of CROT expression in NIH/3T3.)

Western Blot (WB) (CROT monoclonal antibody. Western Blot analysis of CROT expression in NIH/3T3.)
Related Product Information for anti-CROT antibody
Beta-oxidation of fatty acids. The highest activity concerns the C6 to C10 chain length substrate. Converts the end product of pristanic acid beta oxidation, 4,8-dimethylnonanoyl-CoA, to its corresponding carnitine ester.
Product Categories/Family for anti-CROT antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
70kDa
NCBI Official Full Name
peroxisomal carnitine O-octanoyltransferase isoform 2
NCBI Official Synonym Full Names
carnitine O-octanoyltransferase
NCBI Official Symbol
CROT
NCBI Official Synonym Symbols
COT
NCBI Protein Information
peroxisomal carnitine O-octanoyltransferase
UniProt Protein Name
Peroxisomal carnitine O-octanoyltransferase
Protein Family
UniProt Gene Name
CROT
UniProt Synonym Gene Names
COT; COT
UniProt Entry Name
OCTC_HUMAN

NCBI Description

This gene encodes a member of the carnitine/choline acetyltransferase family. The encoded protein converts 4,8-dimethylnonanoyl-CoA to its corresponding carnitine ester. This transesterification occurs in the peroxisome and is necessary for transport of medium- and long- chain acyl-CoA molecules out of the peroxisome to the cytosol and mitochondria. The protein thus plays a role in lipid metabolism and fatty acid beta-oxidation. Alternatively spliced transcript variants have been described.[provided by RefSeq, Jan 2009]

Uniprot Description

CROT: Beta-oxidation of fatty acids. The highest activity concerns the C6 to C10 chain length substrate. Converts the end product of pristanic acid beta oxidation, 4,8-dimethylnonanoyl- CoA, to its corresponding carnitine ester. Belongs to the carnitine/choline acetyltransferase family.

Protein type: EC 2.3.1.137; Transferase

Chromosomal Location of Human Ortholog: 7q21.1

Cellular Component: peroxisomal matrix; intracellular membrane-bound organelle; mitochondrion; peroxisome

Molecular Function: carnitine O-octanoyltransferase activity; receptor binding

Biological Process: coenzyme A metabolic process; fatty acid beta-oxidation using acyl-CoA oxidase; generation of precursor metabolites and energy; fatty acid beta-oxidation; carnitine metabolic process; cellular lipid metabolic process; fatty acid metabolic process; medium-chain fatty acid metabolic process; fatty acid transport

Research Articles on CROT

Similar Products

Product Notes

The CROT crot (Catalog #AAA6136058) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CROT (Peroxisomal Carnitine O-Octanoyltransferase, COT) APC reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CROT can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CROT crot for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CROT, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.