Mouse CROT Monoclonal Antibody | anti-CROT antibody

CROT (Peroxisomal Carnitine O-Octanoyltransferase, COT) APC

Cat. Num. AAA6136058

• Gene Names: CROT; COT
• Reactivity: Human, Mouse, Rat
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: CROT; Monoclonal Antibody; CROT (Peroxisomal Carnitine O-Octanoyltransferase; COT) APC; anti-CROT antibody

• Host: Mouse
• Reactivity: Human, Mouse, Rat
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 1A6
• Specificity: Recognizes human CROT. Species Crossreactivity: mouse and rat.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).

• Applicable Applications for anti-CROT antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa2-100 from human CROT (NP_066974) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: ENQLAKSTEERTFQYQDSLPSLPVPSLEESLKKYLESVKPFANQEEYKKTEEIVQKFQSGIGEKLHQKLLERAKGKRNWLEEWWLNVAYLDVRIPSQL
• Conjugate: APC
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.89kD).)

Western Blot (WB)

(CROT monoclonal antibody, Western Blot analysis of CROT expression in HeLa.)

Western Blot (WB)

(CROT monoclonal antibody. Western Blot analysis of CROT expression in PC-12.)

Western Blot (WB)

(CROT monoclonal antibody. Western Blot analysis of CROT expression in Raw 264.7.)

Western Blot (WB)

(CROT monoclonal antibody. Western Blot analysis of CROT expression in NIH/3T3.)

Related Product Information for anti-CROT antibody

Beta-oxidation of fatty acids. The highest activity concerns the C6 to C10 chain length substrate. Converts the end product of pristanic acid beta oxidation, 4,8-dimethylnonanoyl-CoA, to its corresponding carnitine ester.

Product Categories/Family for anti-CROT antibody

Antibodies; Enzymes; Transferase

NCBI and Uniprot Product Information

• NCBI GI #: 31542325
• NCBI GeneID: 54677
• NCBI Accession #: NP_066974
• NCBI GenBank Nucleotide #: NM_021151
• UniProt Accession #: Q9UKG9
• Molecular Weight: 70kDa
• NCBI Official Full Name: peroxisomal carnitine O-octanoyltransferase isoform 2
• NCBI Official Synonym Full Names: carnitine O-octanoyltransferase
• NCBI Official Symbol: CROT
• NCBI Official Synonym Symbols: COT
• NCBI Protein Information: peroxisomal carnitine O-octanoyltransferase
• UniProt Protein Name: Peroxisomal carnitine O-octanoyltransferase
• Protein Family: Crotasin
• UniProt Gene Name: CROT
• UniProt Synonym Gene Names: COT; COT
• UniProt Entry Name: OCTC_HUMAN

NCBI Description

This gene encodes a member of the carnitine/choline acetyltransferase family. The encoded protein converts 4,8-dimethylnonanoyl-CoA to its corresponding carnitine ester. This transesterification occurs in the peroxisome and is necessary for transport of medium- and long- chain acyl-CoA molecules out of the peroxisome to the cytosol and mitochondria. The protein thus plays a role in lipid metabolism and fatty acid beta-oxidation. Alternatively spliced transcript variants have been described.[provided by RefSeq, Jan 2009]

Uniprot Description

CROT: Beta-oxidation of fatty acids. The highest activity concerns the C6 to C10 chain length substrate. Converts the end product of pristanic acid beta oxidation, 4,8-dimethylnonanoyl- CoA, to its corresponding carnitine ester. Belongs to the carnitine/choline acetyltransferase family.

Protein type: EC 2.3.1.137; Transferase

Chromosomal Location of Human Ortholog: 7q21.1

Cellular Component: peroxisomal matrix; intracellular membrane-bound organelle; mitochondrion; peroxisome

Molecular Function: carnitine O-octanoyltransferase activity; receptor binding

Biological Process: coenzyme A metabolic process; fatty acid beta-oxidation using acyl-CoA oxidase; generation of precursor metabolites and energy; fatty acid beta-oxidation; carnitine metabolic process; cellular lipid metabolic process; fatty acid metabolic process; medium-chain fatty acid metabolic process; fatty acid transport