Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse CRKRS Monoclonal Antibody | anti-CRKRS antibody

CRKRS (Cdc2-Related Kinase, Arginine/Serine-Rich, CRK7, CRKR, KIAA0904) (MaxLight 750)

Gene Names
CDK12; CRK7; CRKR; CRKRS
Applications
Immunofluorescence, Western Blot
Purity
Purified
Synonyms
CRKRS; Monoclonal Antibody; CRKRS (Cdc2-Related Kinase; Arginine/Serine-Rich; CRK7; CRKR; KIAA0904) (MaxLight 750); Cdc2-Related Kinase; KIAA0904; anti-CRKRS antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1H4
Specificity
Recognizes CRKRS.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight750.
Applicable Applications for anti-CRKRS antibody
Immunofluorescence (IF), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
CRKRS (NP_057591, 1281aa-1380aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LVEGDLSSAPQELNPAVTAALLQLLSQPEAEPPGHLPHEHQALRPMEYSTRPRPNRTYGNTDGPETGFSAIDTDERNSGPALTESLVQTLVKNRTFSGSL
Conjugate
MaxLight750
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight750 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-CRKRS antibody
Mouse monoclonal antibody raised against a partial recombinant CRKRS.
Product Categories/Family for anti-CRKRS antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
cyclin-dependent kinase 12 isoform 2
NCBI Official Synonym Full Names
cyclin-dependent kinase 12
NCBI Official Symbol
CDK12
NCBI Official Synonym Symbols
CRK7; CRKR; CRKRS
NCBI Protein Information
cyclin-dependent kinase 12; CDC2-related protein kinase 7; Cdc2-related kinase, arginine/serine-rich; cell division cycle 2-related protein kinase 7; cell division protein kinase 12
UniProt Protein Name
Cyclin-dependent kinase 12
UniProt Gene Name
CDK12
UniProt Synonym Gene Names
CRK7; CRKRS; KIAA0904; CrkRS; CDC2-related protein kinase 7; hCDK12
UniProt Entry Name
CDK12_HUMAN

Uniprot Description

CDK12: a Ser/Thr protein kinase of the CMGC group and CDK family. Phosphorylates the C-terminal heptapeptide repeat domain (CTD) of the largest RNA polymerase II subunit RPB1, thereby acting as a key regulator of transcription elongation. Required for RNA splicing, possibly by phosphorylating SRSF1/SF2. Interacts with CCNL1 and CCNL2. Colocalized with nuclear speckles throughout interphase. Has a highly phosphorylated arginine/serine-rich (RS) domain N-terminal to the kinase domain. Chromosomal aberrations involving CDK12 may be a cause gastric cancer. Deletions within 17q12 region producing fusion transcripts with ERBB2, leading to CDK12-ERBB2 fusion leading to trunctated CDK12 protein not in-frame with ERBB2. Three isoforms of the human protein are produced by alternative splicing.

Protein type: EC 2.7.11.22; Motility/polarity/chemotaxis; Protein kinase, Ser/Thr (non-receptor); Kinase, protein; Cell cycle regulation; Protein kinase, CMGC; RNA splicing; EC 2.7.11.23; Spliceosome; CMGC group; CDK family; CRK7 subfamily; CDK/CRK7 subfamily

Chromosomal Location of Human Ortholog: 17q12

Cellular Component: nucleoplasm; nuclear cyclin-dependent protein kinase holoenzyme complex; nucleolus; nuclear speck; nucleus

Molecular Function: RNA polymerase subunit kinase activity; protein binding; cyclin binding; cyclin-dependent protein kinase activity; ATP binding; protein kinase activity

Biological Process: regulation of cell cycle; protein amino acid autophosphorylation; RNA splicing; regulation of MAP kinase activity; mRNA processing

Research Articles on CRKRS

Similar Products

Product Notes

The CRKRS cdk12 (Catalog #AAA6237750) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's CRKRS can be used in a range of immunoassay formats including, but not limited to, Immunofluorescence (IF), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CRKRS cdk12 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CRKRS, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.