Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (38.21kD).)

Mouse anti-Human CRIM1 Monoclonal Antibody | anti-CRIM1 antibody

CRIM1 (Cysteine-rich Motor Neuron 1 Protein, CRIM-1, Cysteine-rich Repeat-containing Protein S52, S52, UNQ1886/PRO4330, MGC138194) (Biotin)

Gene Names
CRIM1; S52; CRIM-1
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CRIM1; Monoclonal Antibody; CRIM1 (Cysteine-rich Motor Neuron 1 Protein; CRIM-1; Cysteine-rich Repeat-containing Protein S52; S52; UNQ1886/PRO4330; MGC138194) (Biotin); anti-CRIM1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
6E4
Specificity
Recognizes human CRIM1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-CRIM1 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa36-146 from human CRIM1 (NP_057525) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
VCLPCDESKCEEPRNCPGSIVQGVCGCCYTCASQRNESCGGTFGIYGTCDRGLRCVIRPPLNGDSLTEYEAGVCEDENWTDDQLLGFKPCNENLIAGCNIINGKCECNTI
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (38.21kD).)

Western Blot (WB) (Western Blot detection against Immunogen (38.21kD).)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to CRIM1 on formalin-fixed paraffin-embedded human lung. [antibody concentration 3ug/ml].)

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to CRIM1 on formalin-fixed paraffin-embedded human lung. [antibody concentration 3ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged CRIM1 is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged CRIM1 is ~0.03ng/ml as a capture antibody.)
Product Categories/Family for anti-CRIM1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
113,738 Da
NCBI Official Full Name
cysteine-rich motor neuron 1 protein
NCBI Official Synonym Full Names
cysteine rich transmembrane BMP regulator 1 (chordin-like)
NCBI Official Symbol
CRIM1
NCBI Official Synonym Symbols
S52; CRIM-1
NCBI Protein Information
cysteine-rich motor neuron 1 protein; cysteine-rich repeat-containing protein S52
UniProt Protein Name
Cysteine-rich motor neuron 1 protein
UniProt Gene Name
CRIM1
UniProt Synonym Gene Names
S52; CRIM-1
UniProt Entry Name
CRIM1_HUMAN

NCBI Description

This gene encodes a transmembrane protein containing six cysteine-rich repeat domains and an insulin-like growth factor-binding domain. The encoded protein may play a role in tissue development though interactions with members of the transforming growth factor beta family, such as bone morphogenetic proteins. [provided by RefSeq, Nov 2010]

Uniprot Description

CRIM1: May play a role in CNS development by interacting with growth factors implicated in motor neuron differentiation and survival. May play a role in capillary formation and maintenance during angiogenesis. Modulates BMP activity by affecting its processing and delivery to the cell surface.

Protein type: Membrane protein, integral; Receptor, misc.

Chromosomal Location of Human Ortholog: 2p21

Cellular Component: integral to membrane; plasma membrane

Molecular Function: serine-type endopeptidase inhibitor activity; insulin-like growth factor binding; insulin-like growth factor receptor activity; PDZ domain binding

Biological Process: nervous system development; insulin-like growth factor receptor signaling pathway; regulation of cell growth

Research Articles on CRIM1

Similar Products

Product Notes

The CRIM1 crim1 (Catalog #AAA6141356) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CRIM1 (Cysteine-rich Motor Neuron 1 Protein, CRIM-1, Cysteine-rich Repeat-containing Protein S52, S52, UNQ1886/PRO4330, MGC138194) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CRIM1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CRIM1 crim1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CRIM1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.