Mouse anti-Human CRHBP Monoclonal Antibody | anti-CRHBP antibody

CRHBP (Corticotropin-releasing Hormone-binding Protein, CRH-BP, Corticotropin-Releasing Factor-binding Protein, CRF-binding Protein, CRF-BP, CRFBP) (PE)

Cat. Num. AAA6157264

• Gene Names: CRHBP; CRFBP; CRF-BP
• Reactivity: Human
• Applications: ELISA, Immunoprecipitation
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: CRHBP; Monoclonal Antibody; CRHBP (Corticotropin-releasing Hormone-binding Protein; CRH-BP; Corticotropin-Releasing Factor-binding Protein; CRF-binding Protein; CRF-BP; CRFBP) (PE); anti-CRHBP antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 3D9
• Specificity: Recognizes human CRHBP.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-CRHBP antibody: ELISA (EIA), Immunoprecipitation (IP)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant corresponding to aa1-322 from human CRHBP (AAH18038) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MSPNFKLQCHFILIFLTALRGESRYLELREAADYDPFLLFSANLKRELAGEQPYRRALRCLDMLSLQGQFTFTADRPQLHCAAFFISEPEEFITIHYDQVSIDCQGGDFLKVFDGWILKGEKFPSSQDHPLPSAERYIDFCESGLSRRSIRSSQNVAMIFFRVHEPGNGFTLTIKTDPNLFPCNVISQTPNGKFTLVVPHQHRNCSFSIIYPVVIKISDLTLGHVNGLQLKKSSAGCEGIGDFVELLGGTGLDPSKMTPLADLCYPFHGPAQMKVGCDNTVVRMVSSGKHVNRVTFEYRQLEPYELENPNGNSIGEFCLSGL
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Immunoprecipitation (IP)

(Immunoprecipitation of CRHBP transfected lysate using CRHBP monoclonal antibody and Protein A Magnetic Bead and immunoblotted with CRHBP rabbit polyclonal antibody.)

Testing Data

(Detection limit for recombinant GST tagged CRHBP is 3ng/ml as a capture antibody.)

Related Product Information for anti-CRHBP antibody

Corticotropin-releasing hormone is a potent stimulator of synthesis and secretion of preopiomelanocortin-derived peptides. Although CRH concentrations in the human peripheral circulation are normally low, they increase throughout pregnancy and fall rapidly after parturition. Maternal plasma CRH probably originates from the placenta. Human plasma contains a CRH-binding protein (CRHBP) which inactivates CRH and which may prevent inappropriate pituitary-adrenal stimulation in pregnancy.

Product Categories/Family for anti-CRHBP antibody

Antibodies; Binding Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 17390069
• NCBI GeneID: 1393
• Molecular Weight: 36,144 Da
• NCBI Official Full Name: Homo sapiens corticotropin releasing hormone binding protein, mRNA
• NCBI Official Synonym Full Names: corticotropin releasing hormone binding protein
• NCBI Official Symbol: CRHBP
• NCBI Official Synonym Symbols: CRFBP; CRF-BP
• NCBI Protein Information: corticotropin-releasing factor-binding protein
• Protein Family: Corticotropin-releasing factor-binding protein

NCBI Description

Corticotropin-releasing hormone is a potent stimulator of synthesis and secretion of preopiomelanocortin-derived peptides. Although CRH concentrations in the human peripheral circulation are normally low, they increase throughout pregnancy and fall rapidly after parturition. Maternal plasma CRH probably originates from the placenta. Human plasma contains a CRH-binding protein which inactivates CRH and which may prevent inappropriate pituitary-adrenal stimulation in pregnancy. [provided by RefSeq, Jul 2008]