Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human CREB3L4 Monoclonal Antibody | anti-CREB3L4 antibody

CREB3L4 (AIBZIP, Cyclic AMP-responsive Element-binding Protein 3-like Protein 4, cAMP-responsive Element-binding Protein 3-like Protein 4, Androgen-induced Basic Leucine Zipper Protein, AIbZIP, Attaching to CRE-like 1, ATCE1, Cyclic AMP-responsive Element

Gene Names
CREB3L4; JAL; hJAL; ATCE1; CREB3; CREB4; AIBZIP
Reactivity
Human
Applications
Immunofluorescence, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CREB3L4; Monoclonal Antibody; CREB3L4 (AIBZIP; Cyclic AMP-responsive Element-binding Protein 3-like Protein 4; cAMP-responsive Element-binding Protein 3-like Protein 4; Androgen-induced Basic Leucine Zipper Protein; AIbZIP; Attaching to CRE-like 1; ATCE1; Cyclic AMP-responsive Element; anti-CREB3L4 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3E3
Specificity
Recognizes human CREB3L4.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight490.
Sequence Length
395
Applicable Applications for anti-CREB3L4 antibody
FLISA, Immunofluorescence (IF), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa1-111 from human CREB3L4 (NP_570968) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MDLGIPDLLDAWLEPPEDIFSTGSVLELGLHCPPPEVPVTRLQEQGLQGWKSGGDRGCGLQESEPEDFLKLFIDPNEVYCSEASPGSDSGISEDPCHPDSPPAPRATSSP
Conjugate
MaxLight490
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Product Categories/Family for anti-CREB3L4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
cyclic AMP-responsive element-binding protein 3-like protein 4 isoform 1
NCBI Official Synonym Full Names
cAMP responsive element binding protein 3 like 4
NCBI Official Symbol
CREB3L4
NCBI Official Synonym Symbols
JAL; hJAL; ATCE1; CREB3; CREB4; AIBZIP
NCBI Protein Information
cyclic AMP-responsive element-binding protein 3-like protein 4
UniProt Protein Name
Cyclic AMP-responsive element-binding protein 3-like protein 4
UniProt Gene Name
CREB3L4
UniProt Synonym Gene Names
AIBZIP; CREB4; JAL; cAMP-responsive element-binding protein 3-like protein 4; AIbZIP; ATCE1; CREB-4; cAMP-responsive element-binding protein 4; Tisp40
UniProt Entry Name
CR3L4_HUMAN

NCBI Description

This gene encodes a CREB (cAMP responsive element binding) protein with a transmembrane domain which localizes it to the ER membrane. The encoded protein is a transcriptional activator which contains a dimerization domain, and this protein may function in a number of processing pathways including protein processing. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2011]

Uniprot Description

CREB3L4: Transcriptional activator that may play a role in the unfolded protein response. Binds to the UPR element (UPRE) but not to CRE element. Preferentially binds DNA with to the consensus sequence 5'-T[GT]ACGT[GA][GT]-3' and has transcriptional activation activity from UPRE. Binds to NF-kappa-B site and has transcriptional activation activity from NF-kappa-B-containing regulatory elements. Belongs to the bZIP family. ATF subfamily.

Protein type: Transcription factor; Membrane protein, integral; Endoplasmic reticulum

Chromosomal Location of Human Ortholog: 1q21.3

Cellular Component: Golgi membrane; Golgi apparatus; endoplasmic reticulum membrane; endoplasmic reticulum; integral to membrane; nucleus

Biological Process: transcription, DNA-dependent; unfolded protein response; positive regulation of transcription from RNA polymerase II promoter; spermatogenesis

Research Articles on CREB3L4

Similar Products

Product Notes

The CREB3L4 creb3l4 (Catalog #AAA6200281) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CREB3L4 (AIBZIP, Cyclic AMP-responsive Element-binding Protein 3-like Protein 4, cAMP-responsive Element-binding Protein 3-like Protein 4, Androgen-induced Basic Leucine Zipper Protein, AIbZIP, Attaching to CRE-like 1, ATCE1, Cyclic AMP-responsive Element reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CREB3L4 can be used in a range of immunoassay formats including, but not limited to, FLISA, Immunofluorescence (IF), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CREB3L4 creb3l4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CREB3L4, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.