Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Mouse anti-Human CPNE1 Monoclonal Antibody | anti-CPNE1 antibody

CPNE1 (Copine-1, Copine I, CPN1, MGC1142) (PE)

Gene Names
CPNE1; CPN1; COPN1
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CPNE1; Monoclonal Antibody; CPNE1 (Copine-1; Copine I; CPN1; MGC1142) (PE); anti-CPNE1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
8B8
Specificity
Recognizes human CPNE1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-CPNE1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa111-211 from human CPNE1 (NP_003906) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
TLPLMLKPGKPAGRGTITVSAQELKDNRVVTMEVEARNLDKKDFLGKSDPFLEFFRQGDGKWHLVYRSEVIKNNLNPTWKRFSVPVQHFCGGNPSTPIQV
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB)

(CPNE1 monoclonal antibody Western Blot analysis of CPNE1 expression in HeLa.)

Western Blot (WB) (CPNE1 monoclonal antibody Western Blot analysis of CPNE1 expression in HeLa.)

Western Blot (WB)

(Western Blot analysis of CPNE1 expression in transfected 293T cell line by CPNE1 monoclonal antibody Lane 1: CPNE1 transfected lysate (59.1kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of CPNE1 expression in transfected 293T cell line by CPNE1 monoclonal antibody Lane 1: CPNE1 transfected lysate (59.1kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged CPNE1 is ~1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged CPNE1 is ~1ng/ml as a capture antibody.)

Western Blot (WB)

(Western blot analysis of CPNE1 over-expressed 293 cell line, cotransfected with CPNE1 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with CPNE1 monoclonal antibody GAPDH (36.1kD) used as specificity and loading control.)

Western Blot (WB) (Western blot analysis of CPNE1 over-expressed 293 cell line, cotransfected with CPNE1 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with CPNE1 monoclonal antibody GAPDH (36.1kD) used as specificity and loading control.)
Related Product Information for anti-CPNE1 antibody
May function in membrane trafficking. Exhibits calcium-dependent phospholipid binding properties.
Product Categories/Family for anti-CPNE1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
59kDa
NCBI Official Full Name
copine-1 isoform b
NCBI Official Synonym Full Names
copine 1
NCBI Official Symbol
CPNE1
NCBI Official Synonym Symbols
CPN1; COPN1
NCBI Protein Information
copine-1
UniProt Protein Name
Copine-1
Protein Family
UniProt Gene Name
CPNE1
UniProt Synonym Gene Names
CPN1

NCBI Description

Calcium-dependent membrane-binding proteins may regulate molecular events at the interface of the cell membrane and cytoplasm. This gene encodes a calcium-dependent protein that also contains two N-terminal type II C2 domains and an integrin A domain-like sequence in the C-terminus. However, the encoded protein does not contain a predicted signal sequence or transmembrane domains. This protein has a broad tissue distribution and it may function in membrane trafficking. This gene and the gene for RNA binding motif protein 12 overlap at map location 20q11.21. Alternate splicing results in multiple transcript variants encoding different proteins. [provided by RefSeq, Aug 2008]

Uniprot Description

Calcium-dependent phospholipid-binding protein that plays a role in calcium-mediated intracellular processes (PubMed:14674885). Involved in the TNF-alpha receptor signaling pathway in a calcium-dependent manner (PubMed:14674885). Exhibits calcium-dependent phospholipid binding properties (PubMed:9430674, PubMed:19539605). Plays a role in neuronal progenitor cell differentiation; induces neurite outgrowth via a AKT-dependent signaling cascade and calcium-independent manner (PubMed:23263657, PubMed:25450385). May recruit target proteins to the cell membrane in a calcium-dependent manner (PubMed:12522145). May function in membrane trafficking (PubMed:9430674). Involved in TNF-alpha-induced NF-kappa-B transcriptional repression by inducing endoprotease processing of the transcription factor NF-kappa-B p65/RELA subunit (PubMed:18212740). Also induces endoprotease processing of NF-kappa-B p50/NFKB1, p52/NFKB2, RELB and REL (PubMed:18212740).

Research Articles on CPNE1

Similar Products

Product Notes

The CPNE1 cpne1 (Catalog #AAA6157243) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CPNE1 (Copine-1, Copine I, CPN1, MGC1142) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CPNE1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CPNE1 cpne1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CPNE1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.