Mouse anti-Human CPA4 Monoclonal Antibody | anti-CPA4 antibody

CPA4 (Carboxypeptidase A4, Carboxypeptidase A3, UNQ694/PRO1339, CPA3) (FITC)

Cat. Num. AAA6146635

• Gene Names: CPA4; CPA3
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: CPA4; Monoclonal Antibody; CPA4 (Carboxypeptidase A4; Carboxypeptidase A3; UNQ694/PRO1339; CPA3) (FITC); anti-CPA4 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 1F4
• Specificity: Recognizes human CPA4.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

• Applicable Applications for anti-CPA4 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa260-362 from human CPA4 (NP_057436) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: NASFAGKGASDNPCSEVYHGPHANSEVEVKSVVDFIQKHGNFKGFIDLHSYSQLLMYPYGYSVKKAPDAEELDKVARLAAKALASVSGTEYQVGPTCTTVYP
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.33kD).)

Testing Data

(Detection limit for recombinant GST tagged CPA4 is 0.1ng/ml as a capture antibody.)

Related Product Information for anti-CPA4 antibody

CPA4 is a member of the carboxypeptidase A/B subfamily. Carboxypeptidases are zinc-containing exopeptidases that catalyze the release of carboxy-terminal amino acids, and are synthesized as zymogens that are activated by proteolytic cleavage. This protein could be involved in the histone hyperacetylation pathway. It is imprinted and may be a strong candidate protein for prostate cancer aggressiveness.

Product Categories/Family for anti-CPA4 antibody

Antibodies; Enzymes; Carboxypeptidase

NCBI and Uniprot Product Information

• NCBI GI #: 61743916
• NCBI GeneID: 51200
• NCBI Accession #: NP_057436
• NCBI GenBank Nucleotide #: NM_016352
• UniProt Accession #: Q9UI42; Q86UY9; B7Z576
• Molecular Weight: 46.6kDa (413aa) 40-57KDa (SDS-PAGE under reducing conditions.)
• NCBI Official Full Name: carboxypeptidase A4 isoform 1 preproprotein
• NCBI Official Synonym Full Names: carboxypeptidase A4
• NCBI Official Symbol: CPA4
• NCBI Official Synonym Symbols: CPA3
• NCBI Protein Information: carboxypeptidase A4
• UniProt Protein Name: Carboxypeptidase A4
• Protein Family: Carboxypeptidase
• UniProt Gene Name: CPA4
• UniProt Synonym Gene Names: CPA3

NCBI Description

This gene is a member of the carboxypeptidase A/B subfamily, and it is located in a cluster with three other family members on chromosome 7. Carboxypeptidases are zinc-containing exopeptidases that catalyze the release of carboxy-terminal amino acids, and are synthesized as zymogens that are activated by proteolytic cleavage. This gene could be involved in the histone hyperacetylation pathway. It is imprinted and may be a strong candidate gene for prostate cancer aggressiveness. [provided by RefSeq, Jul 2008]

Uniprot Description

CPA4: Metalloprotease that could be involved in the histone hyperacetylation pathway. Belongs to the peptidase M14 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 3.4.17.-; Protease; Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 7q32.2

Cellular Component: extracellular space

Molecular Function: metallocarboxypeptidase activity