Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (35.9kD).)

Mouse anti-Human CPA2 Monoclonal Antibody | anti-CPA2 antibody

CPA2 (Carboxypeptidase A2) (Biotin)

Reactivity
Human
Applications
ELISA, Immunoprecipitation, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CPA2; Monoclonal Antibody; CPA2 (Carboxypeptidase A2) (Biotin); anti-CPA2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
2E11
Specificity
Recognizes human CPA2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Sequence Length
419
Applicable Applications for anti-CPA2 antibody
ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa117-206 from human CPA2 (NP_001860) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
NFGAYHTLEEISQEMDNLVAEHPGLVSKVNIGSSFENRPMNVLKFSTGGDKPAIWLDAGIHAREWVTQATALWTANKIVSDYGKDPSIT*
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (35.9kD).)

Western Blot (WB) (Western Blot detection against Immunogen (35.9kD).)

Western Blot (WB)

(Western Blot analysis of CPA2 expression in transfected 293T cell line by CPA2 monoclonal antibody. Lane 1: CPA2 transfected lysate (46.8kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of CPA2 expression in transfected 293T cell line by CPA2 monoclonal antibody. Lane 1: CPA2 transfected lysate (46.8kD). Lane 2: Non-transfected lysate.)

Immunoprecipitation (IP)

(Immunoprecipitation of CPA2 transfected lysate using CPA2 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with CPA2 rabbit polyclonal antibody.)

Immunoprecipitation (IP) (Immunoprecipitation of CPA2 transfected lysate using CPA2 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with CPA2 rabbit polyclonal antibody.)

Testing Data

(Detection limit for recombinant GST tagged CPA2 is 0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged CPA2 is 0.3ng/ml as a capture antibody.)
Related Product Information for anti-CPA2 antibody
Three different forms of human pancreatic procarboxypeptidase A have been isolated. The encoded protein represents the A2 form, which is a monomeric protein with different biochemical properties from the A1 and A3 forms. The A2 form of pancreatic procarboxypeptidase acts on aromatic C-terminal residues and is a secreted protein.
Product Categories/Family for anti-CPA2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
carboxypeptidase A2
NCBI Official Synonym Full Names
carboxypeptidase A2
NCBI Official Symbol
CPA2
NCBI Protein Information
carboxypeptidase A2
UniProt Protein Name
Carboxypeptidase A2
Protein Family
UniProt Gene Name
CPA2

NCBI Description

Three different forms of human pancreatic procarboxypeptidase A have been isolated. The encoded protein represents the A2 form, which is a monomeric protein with different biochemical properties from the A1 and A3 forms. The A2 form of pancreatic procarboxypeptidase acts on aromatic C-terminal residues and is a secreted protein. [provided by RefSeq, Dec 2008]

Research Articles on CPA2

Similar Products

Product Notes

The CPA2 cpa2 (Catalog #AAA6141330) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CPA2 (Carboxypeptidase A2) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CPA2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CPA2 cpa2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CPA2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.