Mouse anti-Human COX4I2 Monoclonal Antibody | anti-COX4I2 antibody

COX4I2 (Cytochrome C Oxidase Subunit 4 Isoform 2, Mitochondrial, Cytochrome C Oxidase Subunit IV Isoform 2, COX IV-2, COX4L2) (HRP)

Cat. Num. AAA6151931

• Gene Names: COX4I2; COX4; COX4B; COX4-2; COX4L2; COXIV-2; dJ857M17.2
• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Immunoprecipitation, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: COX4I2; Monoclonal Antibody; COX4I2 (Cytochrome C Oxidase Subunit 4 Isoform 2; Mitochondrial; Cytochrome C Oxidase Subunit IV Isoform 2; COX IV-2; COX4L2) (HRP); anti-COX4I2 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 1F2
• Specificity: Recognizes human COX4I2.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-COX4I2 antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Immunoprecipitation (IP), Western Blot (WB)
• Application Notes: IHC-P: 3ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa21-105 from human COX4I2 (NP_115998) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MHSSEGTTRGGGKMSPYTNCYAQRYYPMPEEPFCTELNAEEQALKEKEKGSWTQLTHAEKVALYRLQFNETFAEMNRRSNEWKT
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (35.35kD).)

Western Blot (WB)

(Western Blot analysis of COX4I2 expression in transfected 293T cell line by COX4I2 monoclonal antibody. Lane 1: COX4I2 transfected lysate (20kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to COX4I2 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3ug/ml].)

Immunoprecipitation (IP)

(Immunoprecipitation of COX4I2 transfected lysate using COX4I2 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with COX4I2 rabbit polyclonal antibody.)

Testing Data

(Detection limit for recombinant GST tagged COX4I2 is 0.03ng/ml as a capture antibody.)

Product Categories/Family for anti-COX4I2 antibody

Antibodies; Cytochrome

NCBI and Uniprot Product Information

• NCBI GI #: 17999526
• NCBI GeneID: 84701
• NCBI Accession #: NP_115998
• NCBI GenBank Nucleotide #: NM_032609
• UniProt Accession #: Q96KJ9; Q6GTF4; Q9H0Z4
• Molecular Weight: 20,010 Da
• NCBI Official Full Name: cytochrome c oxidase subunit 4 isoform 2, mitochondrial
• NCBI Official Synonym Full Names: cytochrome c oxidase subunit 4I2
• NCBI Official Symbol: COX4I2
• NCBI Official Synonym Symbols: COX4; COX4B; COX4-2; COX4L2; COXIV-2; dJ857M17.2
• NCBI Protein Information: cytochrome c oxidase subunit 4 isoform 2, mitochondrial
• UniProt Protein Name: Cytochrome c oxidase subunit 4 isoform 2, mitochondrial
• UniProt Gene Name: COX4I2
• UniProt Synonym Gene Names: COX4L2; COX IV-2
• UniProt Entry Name: COX42_HUMAN

NCBI Description

Cytochrome c oxidase (COX), the terminal enzyme of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. It is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may be involved in the regulation and assembly of the complex. This nuclear gene encodes isoform 2 of subunit IV. Isoform 1 of subunit IV is encoded by a different gene, however, the two genes show a similar structural organization. Subunit IV is the largest nuclear encoded subunit which plays a pivotal role in COX regulation. [provided by RefSeq, Jul 2008]

Uniprot Description

COX4I2: This protein is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport. Defects in COX4I2 are the cause of exocrine pancreatic insufficiency dyserythropoietic anemia and calvarial hyperostosis (EPIDACH). Patients present with pancreatic insufficiency, intestinal malabsorption, failure to thrive, and anemia soon after birth. Belongs to the cytochrome c oxidase IV family.

Protein type: Oxidoreductase; Mitochondrial

Chromosomal Location of Human Ortholog: 20q11.21

Cellular Component: mitochondrial respiratory chain complex IV

Molecular Function: cytochrome-c oxidase activity

Biological Process: generation of precursor metabolites and energy; cellular respiration

Disease: Exocrine Pancreatic Insufficiency, Dyserythropoietic Anemia, And Calvarial Hyperostosis