Mouse anti-Human COX4I1 Monoclonal Antibody | anti-COX4I1 antibody

COX4I1 (Cytochrome C Oxidase Subunit 4 Isoform 1, Mitochondrial, Cytochrome C Oxidase Polypeptide IV, Cytochrome C Oxidase Subunit IV Isoform 1, COX IV-1, COX4) (PE)

Cat. Num. AAA6157233

• Gene Names: COX4I1; COX4; COXIV; COX4-1; COXIV-1; COX IV-1
• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: COX4I1; Monoclonal Antibody; COX4I1 (Cytochrome C Oxidase Subunit 4 Isoform 1; Mitochondrial; Cytochrome C Oxidase Polypeptide IV; Cytochrome C Oxidase Subunit IV Isoform 1; COX IV-1; COX4) (PE); anti-COX4I1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 4A10
• Specificity: Recognizes human COX4I1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-COX4I1 antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
• Application Notes: IHC-P: 3ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant corresponding to aa1-169 from human COX4I1 (AAH08704) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MLATRVFSLVGKRAISTSVCVRAHESVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQKALKEKEKASWSSLSMDEKVELYRIKFKESFAEMNRGSNEWKTVVGGAMFFIGFTALVIMWQKHYVYGPLPQSFDKEWVAKQTKRMLDMKVNPIQGLASKWDYEKNEWKK
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (44.33kD).)

Western Blot (WB)

(Western Blot analysis of COX4I1 expression in transfected 293T cell line by COX4I1 monoclonal antibody. Lane 1: COX4I1 transfected lysate (19.6kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to COX4I1 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged COX4I1 is 1ng/ml as a capture antibody.)

Product Categories/Family for anti-COX4I1 antibody

Antibodies; Cytochrome

NCBI and Uniprot Product Information

• NCBI GI #: 14250513
• NCBI GeneID: 1327
• Molecular Weight: 19,577 Da
• NCBI Official Full Name: Homo sapiens cytochrome c oxidase subunit IV isoform 1, mRNA
• NCBI Official Synonym Full Names: cytochrome c oxidase subunit 4I1
• NCBI Official Symbol: COX4I1
• NCBI Official Synonym Symbols: COX4; COXIV; COX4-1; COXIV-1; COX IV-1
• NCBI Protein Information: cytochrome c oxidase subunit 4 isoform 1, mitochondrial
• Protein Family: Cytochrome c oxidase

NCBI Description

Cytochrome c oxidase (COX) is the terminal enzyme of the mitochondrial respiratory chain. It is a multi-subunit enzyme complex that couples the transfer of electrons from cytochrome c to molecular oxygen and contributes to a proton electrochemical gradient across the inner mitochondrial membrane. The complex consists of 13 mitochondrial- and nuclear-encoded subunits. The mitochondrially-encoded subunits perform the electron transfer and proton pumping activities. The functions of the nuclear-encoded subunits are unknown but they may play a role in the regulation and assembly of the complex. This gene encodes the nuclear-encoded subunit IV isoform 1 of the human mitochondrial respiratory chain enzyme. It is located at the 3' of the NOC4 (neighbor of COX4) gene in a head-to-head orientation, and shares a promoter with it. Pseudogenes related to this gene are located on chromosomes 13 and 14. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jan 2016]