Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

Dr1-associated corepressor protein Recombinant Protein | DRAP1 recombinant protein

Recombinant Human Dr1-associated corepressor protein

Gene Names
DRAP1; NC2-alpha
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Dr1-associated corepressor protein; Recombinant Human Dr1-associated corepressor protein; Dr1-associated protein 1; Negative cofactor 2-alpha; NC2-alpha; DRAP1 recombinant protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
4-198aa; Partial
Sequence
KKKKYNARFPPARIKKIMQTDEEIGKVAAAVPVIISRALELFLESLLKKACQVTQSRNAKTMTTSHLKQCIELEQQFDFLKDLVASVPDMQGDGEDNHMDGDKGARRGRKPGSGGRKNGGMGTKSKDKKLSGTDSEQEDESEDTDTDGEEETSQPPPQASHPSAHFQSPPTPFLPFASTLPLPPAPPGPSAPDEE
Sequence Length
205
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

SDS-PAGE
Related Product Information for DRAP1 recombinant protein
The association of the DR1/DRAP1 heterodimer with TBP results in a functional repression of both activated and basal transcription of class II genes. This interaction precludes the formation of a transcription-competent complex by inhibiting the association of TFIIA and/or TFIIB with TBP. Can bind to DNA on its own.
Product Categories/Family for DRAP1 recombinant protein
References
A mechanism for repression of class II gene transcription through specific binding of NC2 to TBP-promoter complexes via heterodimeric histone fold domains.Goppelt A.R., Stelzer G., Lottspeich F., Meisterernst M.EMBO J. 15:3105-3116(1996) Requirement of a corepressor for Dr1-mediated repression of transcription.Mermelstein F., Yeung K., Cao J., Inostroza J.A., Erdjument-Bromage H., Eagelson K., Landsman D., Levitt P., Tempst P., Reinberg D.Genes Dev. 10:1033-1048(1996) NC2alpha interacts with BTAF1 and stimulates its ATP-dependent association with TATA-binding protein.Klejman M.P., Pereira L.A., van Zeeburg H.J.T., Gilfillan S., Meisterernst M., Timmers H.T.M.Mol. Cell. Biol. 24:10072-10082(2004) Initial characterization of the human central proteome.Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.BMC Syst. Biol. 5:17-17(2011) N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.Van Damme P., Lasa M., Polevoda B., Gazquez C., Elosegui-Artola A., Kim D.S., De Juan-Pardo E., Demeyer K., Hole K., Larrea E., Timmerman E., Prieto J., Arnesen T., Sherman F., Gevaert K., Aldabe R.Proc. Natl. Acad. Sci. U.S.A. 109:12449-12454(2012) Crystal structure of negative cofactor 2 recognizing the TBP-DNA transcription complex.Kamada K., Shu F., Chen H., Malik S., Stelzer G., Roeder R.G., Meisterernst M., Burley S.K.Cell 106:71-81(2001)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
48.2 kDa
NCBI Official Full Name
dr1-associated corepressor
NCBI Official Synonym Full Names
DR1 associated protein 1
NCBI Official Symbol
DRAP1
NCBI Official Synonym Symbols
NC2-alpha
NCBI Protein Information
dr1-associated corepressor
UniProt Protein Name
Dr1-associated corepressor
UniProt Gene Name
DRAP1
UniProt Synonym Gene Names
NC2-alpha
UniProt Entry Name
NC2A_HUMAN

NCBI Description

Transcriptional repression is a general mechanism for regulating transcriptional initiation in organisms ranging from yeast to humans. Accurate initiation of transcription from eukaryotic protein-encoding genes requires the assembly of a large multiprotein complex consisting of RNA polymerase II and general transcription factors such as TFIIA, TFIIB, and TFIID. DR1 is a repressor that interacts with the TATA-binding protein (TBP) of TFIID and prevents the formation of an active transcription complex by precluding the entry of TFIIA and/or TFIIB into the preinitiation complex. The protein encoded by this gene is a corepressor of transcription that interacts with DR1 to enhance DR1-mediated repression. The interaction between this corepressor and DR1 is required for corepressor function and appears to stabilize the TBP-DR1-DNA complex. [provided by RefSeq, Jul 2008]

Uniprot Description

The association of the DR1/DRAP1 heterodimer with TBP results in a functional repression of both activated and basal transcription of class II genes. This interaction precludes the formation of a transcription-competent complex by inhibiting the association of TFIIA and/or TFIIB with TBP. Can bind to DNA on its own.

Research Articles on DRAP1

Similar Products

Product Notes

The DRAP1 drap1 (Catalog #AAA717353) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 4-198aa; Partial. The amino acid sequence is listed below: KKKKYNARFP PARIKKIMQT DEEIGKVAAA VPVIISRALE LFLESLLKKA CQVTQSRNAK TMTTSHLKQC IELEQQFDFL KDLVASVPDM QGDGEDNHMD GDKGARRGRK PGSGGRKNGG MGTKSKDKKL SGTDSEQEDE SEDTDTDGEE ETSQPPPQAS HPSAHFQSPP TPFLPFASTL PLPPAPPGPS APDEE. It is sometimes possible for the material contained within the vial of "Dr1-associated corepressor protein, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.