Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (31.5kD).)

Mouse anti-Human COQ2 Monoclonal Antibody | anti-COQ2 antibody

COQ2 (4-hydroxybenzoate Polyprenyltransferase, Mitochondrial, COQ2 Homolog, hCOQ2, Para-hydroxybenzoate--polyprenyltransferase, PHB:polyprenyltransferase, CL640) (HRP)

Gene Names
COQ2; MSA1; CL640; COQ10D1; PHB:PPT
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
COQ2; Monoclonal Antibody; COQ2 (4-hydroxybenzoate Polyprenyltransferase; Mitochondrial; COQ2 Homolog; hCOQ2; Para-hydroxybenzoate--polyprenyltransferase; PHB:polyprenyltransferase; CL640) (HRP); anti-COQ2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2B4
Specificity
Recognizes human COQ2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-COQ2 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa84-133 from human COQ2 (NP_056512) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
AAGAPHGGDLQPPACPEPRGRQLSLSAAAVVDSAPRPLQPYLRLMRLDK*
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (31.5kD).)

Western Blot (WB) (Western Blot detection against Immunogen (31.5kD).)
Related Product Information for anti-COQ2 antibody
Catalyzes the prenylation of para-hydroxybenzoate (PHB) with an all-trans polyprenyl group. Mediates the second step in the final reaction sequence of coenzyme Q (CoQ) biosynthesis, which is the condensation of the polyisoprenoid side chain with PHB.
Product Categories/Family for anti-COQ2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42kDa
NCBI Official Full Name
4-hydroxybenzoate polyprenyltransferase, mitochondrial isoform 1
NCBI Official Synonym Full Names
coenzyme Q2, polyprenyltransferase
NCBI Official Symbol
COQ2
NCBI Official Synonym Symbols
MSA1; CL640; COQ10D1; PHB:PPT
NCBI Protein Information
4-hydroxybenzoate polyprenyltransferase, mitochondrial
UniProt Protein Name
4-hydroxybenzoate polyprenyltransferase, mitochondrial
UniProt Gene Name
COQ2
UniProt Synonym Gene Names
CL640; hCOQ2
UniProt Entry Name
COQ2_HUMAN

NCBI Description

This gene encodes an enzyme that functions in the final steps in the biosynthesis of CoQ (ubiquinone), a redox carrier in the mitochondrial respiratory chain and a lipid-soluble antioxidant. This enzyme, which is part of the coenzyme Q10 pathway, catalyzes the prenylation of parahydroxybenzoate with an all-trans polyprenyl group. Mutations in this gene cause coenzyme Q10 deficiency, a mitochondrial encephalomyopathy, and also COQ2 nephropathy, an inherited form of mitochondriopathy with primary renal involvement. [provided by RefSeq, Oct 2009]

Uniprot Description

Function: Catalyzes the prenylation of para-hydroxybenzoate (PHB) with an all-trans polyprenyl group. Mediates the second step in the final reaction sequence of coenzyme Q (CoQ) biosynthesis, which is the condensation of the polyisoprenoid side chain with PHB. Ref.1

Catalytic activity: A polyprenyl diphosphate + 4-hydroxybenzoate = diphosphate + a 4-hydroxy-3-polyprenylbenzoate. Ref.1

Pathway: Cofactor biosynthesis; ubiquinone biosynthesis.

Subcellular location: Mitochondrion membrane; Multi-pass membrane protein

Probable.

Tissue specificity: Widely expressed. Present in all of the tissues tested. Expressed at higher level in skeletal muscle, adrenal glands and the heart. Ref.1

Involvement in disease: Coenzyme Q10 deficiency, primary, 1 (COQ10D1) [MIM:607426]: An autosomal recessive disorder with variable manifestations consistent with 5 major phenotypes. The phenotypes include an encephalomyopathic form with seizures and ataxia; a multisystem infantile form with encephalopathy, cardiomyopathy and renal failure; a predominantly cerebellar form with ataxia and cerebellar atrophy; Leigh syndrome with growth retardation; and an isolated myopathic form.Note: The disease is caused by mutations affecting the gene represented in this entry. Ref.6 Ref.7

Sequence similarities: Belongs to the UbiA prenyltransferase family.

Sequence caution: The sequence AAC72955.1 differs from that shown. Reason: Frameshift at position 172. The sequence AAH20728.2 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.The sequence CAF18241.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.

Research Articles on COQ2

Similar Products

Product Notes

The COQ2 coq2 (Catalog #AAA6151921) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The COQ2 (4-hydroxybenzoate Polyprenyltransferase, Mitochondrial, COQ2 Homolog, hCOQ2, Para-hydroxybenzoate--polyprenyltransferase, PHB:polyprenyltransferase, CL640) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's COQ2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the COQ2 coq2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "COQ2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.