Western Blot (WB)
(Western Blot analysis of IL6 expression in transfected 293T cell line by IL6 polyclonal antibody. Lane 1: IL6 transfected lysate (23.7kD). Lane 2: Non-transfected lysate.)
Rabbit anti-Human Interleukin 6 Polyclonal Antibody | anti-IL6 antibody
Interleukin 6 (IL6, Interleukin-6, IL-6, B Cell Stimulatory Factor 2, BSF-2, CTL Differentiation Factor, CDF, Hybridoma Growth Factor, Interferon beta-2, IFN-beta-2, IFNB2) APC
Gene Names
IL6; HGF; HSF; BSF2; IL-6; IFNB2
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Interleukin 6; Polyclonal Antibody; Interleukin 6 (IL6; Interleukin-6; IL-6; B Cell Stimulatory Factor 2; BSF-2; CTL Differentiation Factor; CDF; Hybridoma Growth Factor; Interferon beta-2; IFN-beta-2; IFNB2) APC; anti-IL6 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human IL6.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-IL6 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human IL6, aa1-212 (AAH15511.1).
Immunogen Sequence
MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Conjugate
APC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Western Blot (WB)
(Western Blot analysis of IL6 expression in transfected 293T cell line by IL6 polyclonal antibody. Lane 1: IL6 transfected lysate (23.7kD). Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of IL6 expression in transfected 293T cell line by IL6 polyclonal antibody. Lane 1: IL6 transfected lysate (23.7kD). Lane 2: Non-transfected lysate.)
Testing Data
(Proximity Ligation Analysis (PLA) of protein-protein interactions between IL6 and HRH1. HeLa cells were stained with IL6 rabbit purified polyclonal 1:1200 and HRH1 mouse monoclonal antibody 1:50. Signals were detected (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)
Testing Data
(Proximity Ligation Analysis (PLA) of protein-protein interactions between IL6 and HRH1. HeLa cells were stained with IL6 rabbit purified polyclonal 1:1200 and HRH1 mouse monoclonal antibody 1:50. Signals were detected (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)
Related Product Information for anti-IL6 antibody
Interleukin-6 (IL6) is a cytokine that functions in inflammation and the maturation of B cells. The protein is primarily produced at sites of acute and chronic inflammation, where it is secreted into the serum and induces a transcriptional inflammatory response through interleukin 6 receptor, alpha. The functioning of this IL6 is implicated in a wide variety of inflammation-associated disease states, including susceptibility to diabetes mellitus and systemic juvenile rheumatoid arthritis.
Product Categories/Family for anti-IL6 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
21.7 kDa (predicted detection band MW)
NCBI Official Full Name
Interleukin 6 (interferon, beta 2)
NCBI Official Synonym Full Names
interleukin 6
NCBI Official Symbol
IL6
NCBI Official Synonym Symbols
HGF; HSF; BSF2; IL-6; IFNB2
NCBI Protein Information
interleukin-6
UniProt Protein Name
Interleukin-6
Protein Family
UniProt Gene Name
IL6
UniProt Synonym Gene Names
IFNB2; IL-6; BSF-2; CDF; IFN-beta-2
UniProt Entry Name
IL6_HUMAN
NCBI Description
This gene encodes a cytokine that functions in inflammation and the maturation of B cells. In addition, the encoded protein has been shown to be an endogenous pyrogen capable of inducing fever in people with autoimmune diseases or infections. The protein is primarily produced at sites of acute and chronic inflammation, where it is secreted into the serum and induces a transcriptional inflammatory response through interleukin 6 receptor, alpha. The functioning of this gene is implicated in a wide variety of inflammation-associated disease states, including suspectibility to diabetes mellitus and systemic juvenile rheumatoid arthritis. [provided by RefSeq, Jun 2011]
Research Articles on IL6
Similar Products
Product Notes
The IL6 il6 (Catalog #AAA6383015) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Interleukin 6 (IL6, Interleukin-6, IL-6, B Cell Stimulatory Factor 2, BSF-2, CTL Differentiation Factor, CDF, Hybridoma Growth Factor, Interferon beta-2, IFN-beta-2, IFNB2) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Interleukin 6 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the IL6 il6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Interleukin 6, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
