Mouse anti-Human COPS8 Monoclonal Antibody | anti-COPS8 antibody

COPS8 (COP9 Signalosome Complex Subunit 8, SGN8, Signalosome Subunit 8, COP9 Homolog, hCOP9, JAB1-containing Signalosome Subunit 8, CSN8, MGC1297, MGC43256) (FITC)

Cat. Num. AAA6146617

• Gene Names: COPS8; COP9; CSN8; SGN8
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: COPS8; Monoclonal Antibody; COPS8 (COP9 Signalosome Complex Subunit 8; SGN8; Signalosome Subunit 8; COP9 Homolog; hCOP9; JAB1-containing Signalosome Subunit 8; CSN8; MGC1297; MGC43256) (FITC); anti-COPS8 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 2G8
• Specificity: Recognizes human COPS8.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

• Applicable Applications for anti-COPS8 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant corresponding to aa1-210 from human COPS8 (AAH03090) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MPVAVMAESAFSFKKLLDQCENQELEAPGGIATPPVYGQLLALYLLHNDMNNARYLWKRIPPAIKSANSELGGIWSVGQRIWQRDFPGIYTTINAHQWSETVQPIMEALRDATRRRAFALVSQAYTSIIADDFAAFVGLPVEEAVKGILEQGWQADSTTRMVLPRKPVAGALDVSFNKFIPLSEPAPVPPIPNEQQLARLTDYVAFLEN
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (48.73kD).)

Western Blot (WB)

(Western Blot analysis of COPS8 expression in transfected 293T cell line by COPS8 monoclonal antibody Lane 1: COPS8 transfected lysate (23.2kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-COPS8 antibody

Component of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes. The CSN complex is an essential regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunits of SCF-type E3 ligase complexes, leading to decrease the Ubl ligase activity of SCF-type complexes such as SCF, CSA or DDB2. The complex is also involved in phosphorylation of p53/TP53, c-jun/JUN, IkappaBalpha/NFKBIA, ITPK1 and IRF8/ICSBP, possibly via its association with CK2 and PKD kinases. CSN-dependent phosphorylation of TP53 and JUN promotes and protects degradation by the Ubl system, respectively.

Product Categories/Family for anti-COPS8 antibody

Antibodies; Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 13111846
• NCBI GeneID: 10920
• Molecular Weight: 17,909 Da
• NCBI Official Full Name: Homo sapiens COP9 constitutive photomorphogenic homolog subunit 8 (Arabidopsis), mRNA
• NCBI Official Synonym Full Names: COP9 signalosome subunit 8
• NCBI Official Symbol: COPS8
• NCBI Official Synonym Symbols: COP9; CSN8; SGN8
• NCBI Protein Information: COP9 signalosome complex subunit 8

NCBI Description

The protein encoded by this gene is one of the eight subunits of COP9 signalosome, a highly conserved protein complex that functions as an important regulator in multiple signaling pathways. The structure and function of COP9 signalosome is similar to that of the 19S regulatory particle of 26S proteasome. COP9 signalosome has been shown to interact with SCF-type E3 ubiquitin ligases and act as a positive regulator of E3 ubiquitin ligases. Alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq, Jul 2008]