Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (48.73kD).)

Mouse anti-Human COPS8 Monoclonal Antibody | anti-COPS8 antibody

COPS8 (COP9 Signalosome Complex Subunit 8, SGN8, Signalosome Subunit 8, COP9 Homolog, hCOP9, JAB1-containing Signalosome Subunit 8, CSN8, MGC1297, MGC43256) (Biotin)

Gene Names
COPS8; COP9; CSN8; SGN8
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
COPS8; Monoclonal Antibody; COPS8 (COP9 Signalosome Complex Subunit 8; SGN8; Signalosome Subunit 8; COP9 Homolog; hCOP9; JAB1-containing Signalosome Subunit 8; CSN8; MGC1297; MGC43256) (Biotin); anti-COPS8 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2G8
Specificity
Recognizes human COPS8.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-COPS8 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-210 from human COPS8 (AAH03090) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MPVAVMAESAFSFKKLLDQCENQELEAPGGIATPPVYGQLLALYLLHNDMNNARYLWKRIPPAIKSANSELGGIWSVGQRIWQRDFPGIYTTINAHQWSETVQPIMEALRDATRRRAFALVSQAYTSIIADDFAAFVGLPVEEAVKGILEQGWQADSTTRMVLPRKPVAGALDVSFNKFIPLSEPAPVPPIPNEQQLARLTDYVAFLEN
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (48.73kD).)

Western Blot (WB) (Western Blot detection against Immunogen (48.73kD).)

Western Blot (WB)

(Western Blot analysis of COPS8 expression in transfected 293T cell line by COPS8 monoclonal antibody Lane 1: COPS8 transfected lysate (23.2kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of COPS8 expression in transfected 293T cell line by COPS8 monoclonal antibody Lane 1: COPS8 transfected lysate (23.2kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-COPS8 antibody
Component of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes. The CSN complex is an essential regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunits of SCF-type E3 ligase complexes, leading to decrease the Ubl ligase activity of SCF-type complexes such as SCF, CSA or DDB2. The complex is also involved in phosphorylation of p53/TP53, c-jun/JUN, IkappaBalpha/NFKBIA, ITPK1 and IRF8/ICSBP, possibly via its association with CK2 and PKD kinases. CSN-dependent phosphorylation of TP53 and JUN promotes and protects degradation by the Ubl system, respectively.
Product Categories/Family for anti-COPS8 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
17,909 Da
NCBI Official Full Name
Homo sapiens COP9 constitutive photomorphogenic homolog subunit 8 (Arabidopsis), mRNA
NCBI Official Synonym Full Names
COP9 signalosome subunit 8
NCBI Official Symbol
COPS8
NCBI Official Synonym Symbols
COP9; CSN8; SGN8
NCBI Protein Information
COP9 signalosome complex subunit 8

NCBI Description

The protein encoded by this gene is one of the eight subunits of COP9 signalosome, a highly conserved protein complex that functions as an important regulator in multiple signaling pathways. The structure and function of COP9 signalosome is similar to that of the 19S regulatory particle of 26S proteasome. COP9 signalosome has been shown to interact with SCF-type E3 ubiquitin ligases and act as a positive regulator of E3 ubiquitin ligases. Alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq, Jul 2008]

Research Articles on COPS8

Similar Products

Product Notes

The COPS8 (Catalog #AAA6141314) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The COPS8 (COP9 Signalosome Complex Subunit 8, SGN8, Signalosome Subunit 8, COP9 Homolog, hCOP9, JAB1-containing Signalosome Subunit 8, CSN8, MGC1297, MGC43256) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's COPS8 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the COPS8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "COPS8, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.