Mouse anti-Human, Mouse COL4A3BP Monoclonal Antibody | anti-COL4A3BP antibody
COL4A3BP (Collagen Type IV alpha-3-binding Protein, Ceramide Transfer Protein, hCERT, Goodpasture Antigen-binding Protein, GPBP, START Domain-containing Protein 11, StARD11, StAR-related Lipid Transfer Protein 11, CERT, STARD11) (MaxLight 490)
Gene Names
CERT1; CERT; GPBP; CERTL; MRD34; STARD11; COL4A3BP
Reactivity
Human, Mouse
Applications
FLISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
COL4A3BP; Monoclonal Antibody; COL4A3BP (Collagen Type IV alpha-3-binding Protein; Ceramide Transfer Protein; hCERT; Goodpasture Antigen-binding Protein; GPBP; START Domain-containing Protein 11; StARD11; StAR-related Lipid Transfer Protein 11; CERT; STARD11) (MaxLight 490); anti-COL4A3BP antibody
Host
Mouse
Reactivity
Human, Mouse
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
1A1
Specificity
Recognizes human COL4A3BP.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight490.
Sequence Length
7934
Applicable Applications for anti-COL4A3BP antibody
FLISA
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa499-598 from COL4A3BP (NP_112729) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
TWIVCNFSVDHDSAPLNNRCVRAKINVAMICQTLVSPPEGNQEISRDNILCKITYVANVNPGGWAPASVLRAVAKREYPKFLKRFTSYVQEKTAGKPILF
Conjugate
MaxLight490
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-COL4A3BP antibody
COL4A3BP is a kinase that specifically phosphorylates the N-terminal region of the non-collagenous domain of the alpha 3 chain of type IV collagen, known as the Goodpasture antigen. Goodpasture disease is the result of an autoimmune response directed at this antigen. Two transcripts exist for the gene encodign this protein.
Product Categories/Family for anti-COL4A3BP antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
NCBI Official Full Name
Homo sapiens ceramide transporter 1 (CERT1), transcript variant 2, mRNA
NCBI Official Synonym Full Names
ceramide transporter 1
NCBI Official Symbol
CERT1
NCBI Official Synonym Symbols
CERT; GPBP; CERTL; MRD34; STARD11; COL4A3BP
NCBI Protein Information
ceramide transfer protein
Protein Family
NCBI Description
This gene encodes a kinase that specifically phosphorylates the N-terminal region of the non-collagenous domain of the alpha 3 chain of type IV collagen, known as the Goodpasture antigen. Goodpasture disease is the result of an autoimmune response directed at this antigen. One isoform of this protein is also involved in ceramide intracellular transport. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
Research Articles on COL4A3BP
Similar Products
Product Notes
The COL4A3BP (Catalog #AAA6200224) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The COL4A3BP (Collagen Type IV alpha-3-binding Protein, Ceramide Transfer Protein, hCERT, Goodpasture Antigen-binding Protein, GPBP, START Domain-containing Protein 11, StARD11, StAR-related Lipid Transfer Protein 11, CERT, STARD11) (MaxLight 490) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's COL4A3BP can be used in a range of immunoassay formats including, but not limited to, FLISA. Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the COL4A3BP for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "COL4A3BP, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
