Mouse anti-Human COG2 Monoclonal Antibody | anti-COG2 antibody

COG2 (LDLC, Conserved Oligomeric Golgi Complex Subunit 2, Component of Oligomeric Golgi Complex 2, Low Density Lipoprotein Receptor Defect C-complementing Protein) (PE)

Cat. Num. AAA6157189

• Gene Names: COG2; LDLC; CDG2Q
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: COG2; Monoclonal Antibody; COG2 (LDLC; Conserved Oligomeric Golgi Complex Subunit 2; Component of Oligomeric Golgi Complex 2; Low Density Lipoprotein Receptor Defect C-complementing Protein) (PE); anti-COG2 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 4C8
• Specificity: Recognizes human COG2.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-COG2 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa639-739 from COG2 (NP_031383) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: LSESTHKYYETVSDVLNSVKKMEESLKRLKQARKTTPANPVGPSGGMSDDDKIRLQLALDVEYLGEQIQKLGLQASDIKSFSALAELVAAAKDQATAEQP*
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB)

(Western Blot analysis of COG2 expression in transfected 293T cell line by COG2 monoclonal antibody. Lane 1: COG2 transfected lysate (83.2kD). Lane 2: Non-transfected lysate.)

Western Blot (WB)

(Western blot analysis of COG2 over-expressed 293 cell line, cotransfected with COG2 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with COG2 monoclonal antibody GAPDH (36.1kD) used as specificity and loading control.)

Product Categories/Family for anti-COG2 antibody

Antibodies; Golgi Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 6678676
• NCBI GeneID: 22796
• NCBI Accession #: NP_031383
• NCBI GenBank Nucleotide #: NM_007357
• UniProt Accession #: Q14746
• Molecular Weight: 83kDa
• NCBI Official Full Name: conserved oligomeric Golgi complex subunit 2 isoform 1
• NCBI Official Synonym Full Names: component of oligomeric golgi complex 2
• NCBI Official Symbol: COG2
• NCBI Official Synonym Symbols: LDLC; CDG2Q
• NCBI Protein Information: conserved oligomeric Golgi complex subunit 2
• UniProt Protein Name: Conserved oligomeric Golgi complex subunit 2
• Protein Family: Conserved oligomeric Golgi complex
• UniProt Gene Name: COG2
• UniProt Synonym Gene Names: LDLC; COG complex subunit 2
• UniProt Entry Name: COG2_HUMAN

NCBI Description

This gene encodes a subunit of the conserved oligomeric Golgi complex that is required for maintaining normal structure and activity of the Golgi complex. The encoded protein specifically interacts with the USO1 vesicle docking protein and may be necessary for normal Golgi ribbon formation and trafficking of Golgi enzymes. Mutations of this gene are associated with abnormal glycosylation within the Golgi apparatus. Alternative splicing results in multiple transcript variants.[provided by RefSeq, Feb 2009]

Uniprot Description

COG2: Required for normal Golgi morphology and function. Belongs to the COG2 family. 2 isoforms of the human protein are produced by alternative splicing.

Chromosomal Location of Human Ortholog: 1q42.2

Cellular Component: Golgi membrane; Golgi stack; Golgi transport complex; cytosol

Molecular Function: protein binding; protein complex binding; protein transporter activity

Biological Process: intracellular protein transport; intra-Golgi vesicle-mediated transport; oligosaccharide biosynthetic process; protein amino acid glycosylation; Golgi organization and biogenesis