Mouse anti-Human CMTM7 Monoclonal Antibody | anti-CMTM7 antibody

CMTM7 (CKLFSF7, CKLF-like MARVEL Transmembrane Domain-containing Protein 7, Chemokine-like Factor Superfamily Member 7, FLJ30992)

Cat. Num. AAA6011905

• Gene Names: CMTM7; CKLFSF7
• Reactivity: Human
• Applications: ELISA
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: CMTM7; Monoclonal Antibody; CMTM7 (CKLFSF7; CKLF-like MARVEL Transmembrane Domain-containing Protein 7; Chemokine-like Factor Superfamily Member 7; FLJ30992); Anti -CMTM7 (CKLFSF7; anti-CMTM7 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 2B1-G4
• Specificity: Recognizes human CKLFSF7.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: MSHGAGLVRTTCSSGSALGPGAGAAQPSASPLEGLLDLSYPRTHAALLKVAQMVTLLIAFICVRSSLWTNYSAYSYFEVVTICDLIMILAFYLVHLFRFYRVLTCISWPLSELLHYLIGTLLLLIASIVAASKSYNQSGLVAGAIFGFMATFLCMASIWLSYKISCVTQSTDAAV

• Applicable Applications for anti-CMTM7 antibody: ELISA (EL/EIA)
• Application Notes: Suitable for use in ELISA.
• Immunogen: Full length recombinant corresponding to aa1-176 from human CKLFSF7 (AAH10116) with GST tag. MW of the GST tag alone is 26kD.
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Product Categories/Family for anti-CMTM7 antibody

Antibodies; Abs to Membrane Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 31657099
• NCBI GeneID: 112616
• NCBI Accession #: NP_852137.1
• NCBI GenBank Nucleotide #: NM_181472.1
• UniProt Accession #: Q96FZ5; Q5VLK1
• Molecular Weight: 18,834 Da
• NCBI Official Full Name: CKLF-like MARVEL transmembrane domain-containing protein 7 isoform b
• NCBI Official Synonym Full Names: CKLF-like MARVEL transmembrane domain containing 7
• NCBI Official Symbol: CMTM7
• NCBI Official Synonym Symbols: CKLFSF7
• NCBI Protein Information: CKLF-like MARVEL transmembrane domain-containing protein 7; chemokine-like factor superfamily 7; chemokine-like factor super family 7; chemokine-like factor superfamily member 7; chemokine-like factor super family member 7 variant 2
• UniProt Protein Name: CKLF-like MARVEL transmembrane domain-containing protein 7
• Protein Family: CKLF-like MARVEL transmembrane domain-containing protein
• UniProt Gene Name: CMTM7
• UniProt Synonym Gene Names: CKLFSF7
• UniProt Entry Name: CKLF7_HUMAN

NCBI Description

This gene belongs to the chemokine-like factor gene superfamily, a novel family that is similar to the chemokine and transmembrane 4 superfamilies. This gene is one of several chemokine-like factor genes located in a cluster on chromosome 3. The protein encoded by this gene is highly expressed in leukocytes, but its exact function is unknown. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008]

Uniprot Description

CMTM7: a member of the chemokine-like factor gene superfamily, a novel family that is similar to the chemokine and transmembrane 4 superfamilies. This gene is one of several chemokine-like factor genes located in a cluster on chromosome 3. The protein encoded by this gene is highly expressed in leukocytes, but its exact function is unknown. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008]

Protein type: Motility/polarity/chemotaxis; Membrane protein, multi-pass; Membrane protein, integral; Cytokine

Chromosomal Location of Human Ortholog: 3p22.3

Cellular Component: extracellular space; membrane; integral to membrane

Molecular Function: cytokine activity

Biological Process: B-1a B cell differentiation; chemotaxis