Mouse anti-Human CMC4 Monoclonal Antibody | anti-CMC4 antibody

CMC4 (Mature T-cell Proliferation 1 Neighbor Protein, Cx9C Motif-containing Protein 4, Mature T-cell Proliferation-1 Type A, MTCP-1 type A, Protein p8 MTCP-1, p8MTCP1, C6.1B, MTCP1, MTCP1NB)

Cat. Num. AAA647713

• Gene Names: CMC4; p8; C6.1B; MTCP1; MTCP1B; MTCP1NB; p8MTCP1
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: CMC4; Monoclonal Antibody; CMC4 (Mature T-cell Proliferation 1 Neighbor Protein; Cx9C Motif-containing Protein 4; Mature T-cell Proliferation-1 Type A; MTCP-1 type A; Protein p8 MTCP-1; p8MTCP1; C6.1B; MTCP1; MTCP1NB); Anti -CMC4 (Mature T-cell Proliferation 1 Neighbor Protein; anti-CMC4 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 1G12
• Specificity: Recognizes human MTCP1.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: MPQKDPCQKQACEIQKCLQANSYMESKCQAVIQELRKCCAQYPKGRSVVCSGFEKEEEENLTRKSASK

• Applicable Applications for anti-CMC4 antibody: ELISA (EL/EIA), Western Blot (WB)
• Application Notes: Suitable for use in ELISA and Western Blot.
• Immunogen: Full length recombinant corresponding to aa1-68 from human MTCP1 (AAH02600) with GST tag. MW of the GST tag alone is 26kD.
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (33kD).)

Western Blot (WB)

(Western Blot analysis of MTCP1 expression in transfected 293T cell line by MTCP1 monoclonal antibody.|Lane 1: MTCP1 transfected lysate (Predicted MW: 7.7kD).|Lane 2: Non-transfected lysate)

Testing Data

(Detection limit for recombinant GST tagged MTCP1 is 0.1ng/ml as a capture antibody.)

Product Categories/Family for anti-CMC4 antibody

Antibodies; Abs to Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 66346713
• NCBI GeneID: 100272147
• NCBI Accession #: NP_001018024.1
• NCBI GenBank Nucleotide #: NM_001018024.2
• UniProt Accession #: P56277; Q5HYP9
• Molecular Weight: 7,747 Da
• NCBI Official Full Name: cx9C motif-containing protein 4
• NCBI Official Synonym Full Names: C-x(9)-C motif containing 4 homolog (S. cerevisiae)
• NCBI Official Symbol: CMC4
• NCBI Official Synonym Symbols: p8; C6.1B; MTCP1; MTCP1B; MTCP1NB; p8MTCP1
• NCBI Protein Information: cx9C motif-containing protein 4; MTCP-1 type A; protein p8 MTCP-1; mature T-cell proliferation-1 type A; mature T-cell proliferation 1, isoform p8; mature T-cell proliferation 1 neighbor protein
• UniProt Protein Name: Cx9C motif-containing protein 4
• Protein Family: Cx9C motif-containing protein
• UniProt Gene Name: CMC4
• UniProt Synonym Gene Names: C6.1B; MTCP1; MTCP1NB; MTCP-1 type A; p8MTCP1
• UniProt Entry Name: CMC4_HUMAN

NCBI Description

This gene was identified by involvement in some t(X;14) translocations associated with mature T-cell proliferations. This region has a complex gene structure, with a common promoter and 5' exon spliced to two different sets of 3' exons that encode two different proteins. This gene represents the downstream 8 kDa protein that localizes to mitochondria.[provided by RefSeq, Mar 2009]

Uniprot Description

Subcellular location: Mitochondrion Ref.6.

Tissue specificity: Expressed in many tissues with a relatively high level in skeletal muscle.

Domain: The twin Cx9C motifs are involved in the recognition by the mitochondrial disulfide relay system

By similarity.

Involvement in disease: Overexpressed in T-cell leukemia bearing a t(X;14) translocation.

Sequence similarities: Belongs to the CMC4 family.

Caution: MTCP1 and MTCP1NB are transcribed from the same promoter and could be considered the same gene.