Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.73kD).)

Mouse anti-Human CLTC Monoclonal Antibody | anti-CLTC antibody

CLTC (Clathrin Heavy Chain 1, Clathrin Heavy Chain on Chromosome 17, CLH-17, CLH17, CLTCL2, KIAA0034) (Biotin)

Gene Names
CLTC; Hc; CHC; CHC17; MRD56; CLH-17; CLTCL2
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CLTC; Monoclonal Antibody; CLTC (Clathrin Heavy Chain 1; Clathrin Heavy Chain on Chromosome 17; CLH-17; CLH17; CLTCL2; KIAA0034) (Biotin); anti-CLTC antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2E5
Specificity
Recognizes human CLTC.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Sequence Length
1675
Applicable Applications for anti-CLTC antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa232-340 from human CLTC (NP_004850) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
EVGTPPTGNQPFPKKAVDVFFPPEAQNDFPVAMQISEKHDVVFLITKYGYIHLYDLETGTCIYMNRISGETIFVTAPHEATAGIIGVNRKGQVLSVCVEEENIIPYITN
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.73kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.73kD).)

Testing Data

(Detection limit for recombinant GST tagged CLTC is 0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged CLTC is 0.3ng/ml as a capture antibody.)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between HIP1 and CLTC. HeLa cells were stained with HIP1 rabbit purified polyclonal 1:1200 and CLTC mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Testing Data (Proximity Ligation Analysis (PLA) of protein-protein interactions between HIP1 and CLTC. HeLa cells were stained with HIP1 rabbit purified polyclonal 1:1200 and CLTC mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)
Related Product Information for anti-CLTC antibody
Clathrin-coated pits, intracellular transport vesicles involved in endocytosis and other membrane trafficking processes, are multi-component units. Clathrin, the most abundant protein in these vesicles, is formed of a basic assembly unit called a triskelion composed of three clathrin heavy chains and three clathrin light chains. Together with other coat components such as AP2, epsin and EPS15, triskelia are targeted to appropriate membrane fusion sites, where subsequent invagination, cargo protein uptake and vesicle internalization occurs.
Product Categories/Family for anti-CLTC antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
clathrin heavy chain 1 isoform 1
NCBI Official Synonym Full Names
clathrin heavy chain
NCBI Official Symbol
CLTC
NCBI Official Synonym Symbols
Hc; CHC; CHC17; MRD56; CLH-17; CLTCL2
NCBI Protein Information
clathrin heavy chain 1
UniProt Protein Name
Clathrin heavy chain 1
Protein Family
UniProt Gene Name
CLTC
UniProt Synonym Gene Names
CLH17; CLTCL2; KIAA0034; CLH-17

NCBI Description

Clathrin is a major protein component of the cytoplasmic face of intracellular organelles, called coated vesicles and coated pits. These specialized organelles are involved in the intracellular trafficking of receptors and endocytosis of a variety of macromolecules. The basic subunit of the clathrin coat is composed of three heavy chains and three light chains. [provided by RefSeq, Jul 2008]

Uniprot Description

Clathrin is the major protein of the polyhedral coat of coated pits and vesicles. Two different adapter protein complexes link the clathrin lattice either to the plasma membrane or to the trans-Golgi network. Acts as component of the TACC3/ch-TOG/clathrin complex proposed to contribute to stabilization of kinetochore fibers of the mitotic spindle by acting as inter-microtubule bridge (PubMed:15858577, PubMed:16968737, PubMed:21297582). The TACC3/ch-TOG/clathrin complex is required for the maintenance of kinetochore fiber tension (PubMed:23532825). Plays a role in early autophagosome formation (PubMed:20639872).

Research Articles on CLTC

Similar Products

Product Notes

The CLTC cltc (Catalog #AAA6141259) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CLTC (Clathrin Heavy Chain 1, Clathrin Heavy Chain on Chromosome 17, CLH-17, CLH17, CLTCL2, KIAA0034) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CLTC can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CLTC cltc for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CLTC, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.