Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (32.23kD).)

Mouse anti-Human CLTA Monoclonal Antibody | anti-CLTA antibody

CLTA (Clathrin Light Chain A, Lca)

Gene Names
CLTA; LCA
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
CLTA; Monoclonal Antibody; CLTA (Clathrin Light Chain A; Lca); Anti -CLTA (Clathrin Light Chain A; anti-CLTA antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4E9
Specificity
Recognizes human CLTA.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MERLEALDANSRKQEAEWKEKAIKELEEWYARQDEQLQKTKANNRAAEEAFVNDIDESS
Applicable Applications for anti-CLTA antibody
ELISA (EL/EIA), Western Blot (WB)
Application Notes
Suitable for use in ELISA and Western Blot.
Immunogen
Partial recombinant corresponding to aa118-176 from human CLTA (NP_001824.1) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (32.23kD).)

Western Blot (WB) (Western Blot detection against Immunogen (32.23kD).)
Related Product Information for anti-CLTA antibody
Clathrin is a large, soluble protein composed of heavy and light chains. It functions as the main structural component of the lattice-type cytoplasmic face of coated pits and vesicles which entrap specific macromolecules during receptor-mediated endocytosis. CLTA is one of two clathrin light chain proteins which are believed to function as regulatory elements.
Product Categories/Family for anti-CLTA antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
27,077 Da
NCBI Official Full Name
clathrin light chain A isoform e
NCBI Official Synonym Full Names
clathrin, light chain A
NCBI Official Symbol
CLTA
NCBI Official Synonym Symbols
LCA
NCBI Protein Information
clathrin light chain A; clathrin, light polypeptide (Lca)
UniProt Protein Name
Clathrin light chain A
Protein Family
UniProt Gene Name
CLTA
UniProt Synonym Gene Names
Lca
UniProt Entry Name
CLCA_HUMAN

NCBI Description

Clathrin is a large, soluble protein composed of heavy and light chains. It functions as the main structural component of the lattice-type cytoplasmic face of coated pits and vesicles which entrap specific macromolecules during receptor-mediated endocytosis. This gene encodes one of two clathrin light chain proteins which are believed to function as regulatory elements. Alternative splicing results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 8 and 12. [provided by RefSeq, May 2010]

Uniprot Description

CLTA: Clathrin is the major protein of the polyhedral coat of coated pits and vesicles. Belongs to the clathrin light chain family. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Vesicle; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 9p13

Cellular Component: clathrin coat of trans-Golgi network vesicle; clathrin coat; intracellular membrane-bound organelle; membrane; cytoplasmic membrane-bound vesicle; plasma membrane; trans-Golgi network membrane; cytosol; clathrin coat of coated pit

Molecular Function: protein binding; clathrin heavy chain binding; structural molecule activity; peptide binding

Biological Process: negative regulation of epidermal growth factor receptor signaling pathway; epidermal growth factor receptor signaling pathway; axon guidance; intracellular protein transport; nerve growth factor receptor signaling pathway; antigen processing and presentation of exogenous peptide antigen via MHC class II; endocytosis; post-Golgi vesicle-mediated transport

Research Articles on CLTA

Similar Products

Product Notes

The CLTA clta (Catalog #AAA6010628) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CLTA (Clathrin Light Chain A, Lca) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CLTA can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Suitable for use in ELISA and Western Blot. Researchers should empirically determine the suitability of the CLTA clta for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MERLEALDAN SRKQEAEWKE KAIKELEEWY ARQDEQLQKT KANNRAAEEA FVNDIDESS. It is sometimes possible for the material contained within the vial of "CLTA, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.