Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human, Rat CLPP Monoclonal Antibody | anti-CLPP antibody

CLPP (Putative ATP-dependent Clp Protease Proteolytic Subunit, Mitochondrial, Endopeptidase Clp) (MaxLight 405)

Gene Names
CLPP; DFNB81; PRLTS3
Reactivity
Human, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CLPP; Monoclonal Antibody; CLPP (Putative ATP-dependent Clp Protease Proteolytic Subunit; Mitochondrial; Endopeptidase Clp) (MaxLight 405); anti-CLPP antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Rat
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
3E2
Specificity
Recognizes human CLPP. Species Crossreactivity: rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight405.
Applicable Applications for anti-CLPP antibody
FLISA, Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 1ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa178-278 from CLPP (NP_006003) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
HQPSGGARGQATDIAIQAEEIMKLKKQLYNIYAKHTKQSLQVIESAMERDRYMSPMEAQEFGILDKVLVHPPQDGEDEPTLVQKEPVEAAPAAEPVPAST*
Conjugate
MaxLight405
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight405 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Product Categories/Family for anti-CLPP antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24.2kDa (222aa), confirmed by MALDI-TOF
NCBI Official Full Name
ATP-dependent Clp protease proteolytic subunit, mitochondrial
NCBI Official Synonym Full Names
caseinolytic mitochondrial matrix peptidase proteolytic subunit
NCBI Official Symbol
CLPP
NCBI Official Synonym Symbols
DFNB81; PRLTS3
NCBI Protein Information
ATP-dependent Clp protease proteolytic subunit, mitochondrial
UniProt Protein Name
ATP-dependent Clp protease proteolytic subunit, mitochondrial
UniProt Gene Name
CLPP
UniProt Entry Name
CLPP_HUMAN

NCBI Description

The protein encoded by this gene belongs to the peptidase family S14 and hydrolyzes proteins into small peptides in the presence of ATP and magnesium. The protein is transported into mitochondrial matrix and is associated with the inner mitochondrial membrane. [provided by RefSeq, Jul 2008]

Uniprot Description

CLPP: Clp cleaves peptides in various proteins in a process that requires ATP hydrolysis. Clp may be responsible for a fairly general and central housekeeping function rather than for the degradation of specific substrates. Belongs to the peptidase S14 family.

Protein type: Mitochondrial; EC 3.4.21.92; Protease

Chromosomal Location of Human Ortholog: 19p13.3

Cellular Component: mitochondrion; mitochondrial matrix

Molecular Function: peptidase activity; identical protein binding; protein binding; serine-type endopeptidase activity

Biological Process: proteolysis involved in cellular protein catabolic process; protein homooligomerization

Disease: Perrault Syndrome 3

Research Articles on CLPP

Similar Products

Product Notes

The CLPP clpp (Catalog #AAA6189512) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CLPP (Putative ATP-dependent Clp Protease Proteolytic Subunit, Mitochondrial, Endopeptidase Clp) (MaxLight 405) reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CLPP can be used in a range of immunoassay formats including, but not limited to, FLISA, Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 1ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CLPP clpp for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CLPP, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.