Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged CLIP3 is 0.3ng/ml as a capture antibody.)

Mouse anti-Human CLIP3 Monoclonal Antibody | anti-CLIP3 antibody

CLIP3 (CLIPR59, CAP-Gly Domain-containing Linker Protein 3, Cytoplasmic Linker Protein 170-related 59kD Protein) (AP)

Gene Names
CLIP3; RSNL1; CLIPR59; CLIPR-59
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CLIP3; Monoclonal Antibody; CLIP3 (CLIPR59; CAP-Gly Domain-containing Linker Protein 3; Cytoplasmic Linker Protein 170-related 59kD Protein) (AP); anti-CLIP3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
4C11
Specificity
Recognizes human CLIP3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Sequence Length
547
Applicable Applications for anti-CLIP3 antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa447-548 from human CLIP3 (NP_056341) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
GIELDQPTGKHDGSVFGVRYFTCPPRHGVFAPASRIQRIGGSTDSPGDSVGAKKVHQVTMTQPKRTFTTVRTPKDIASENSISRLLFCCWFPWMLRAEMQS*
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged CLIP3 is 0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged CLIP3 is 0.3ng/ml as a capture antibody.)
Related Product Information for anti-CLIP3 antibody
Functions as a cytoplasmic linker protein. Involved in TGN-endosome dynamics.
Product Categories/Family for anti-CLIP3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
CAP-Gly domain-containing linker protein 3
NCBI Official Synonym Full Names
CAP-Gly domain containing linker protein 3
NCBI Official Symbol
CLIP3
NCBI Official Synonym Symbols
RSNL1; CLIPR59; CLIPR-59
NCBI Protein Information
CAP-Gly domain-containing linker protein 3
UniProt Protein Name
CAP-Gly domain-containing linker protein 3
UniProt Gene Name
CLIP3
UniProt Synonym Gene Names
CLIPR59; CLIP-170-related 59 kDa protein; CLIPR-59
UniProt Entry Name
CLIP3_HUMAN

NCBI Description

This gene encodes a member of the cytoplasmic linker protein 170 family. Members of this protein family contain a cytoskeleton-associated protein glycine-rich domain and mediate the interaction of microtubules with cellular organelles. The encoded protein plays a role in T cell apoptosis by facilitating the association of tubulin and the lipid raft ganglioside GD3. The encoded protein also functions as a scaffold protein mediating membrane localization of phosphorylated protein kinase B. Alternatively spliced transcript variants have been observed for this gene. [provided by RefSeq, Dec 2010]

Uniprot Description

CLIPR-59: Functions as a cytoplasmic linker protein. Involved in TGN-endosome dynamics.

Protein type: Unknown function

Chromosomal Location of Human Ortholog: 19q13.12

Cellular Component: Golgi stack; early endosome membrane; recycling endosome membrane; plasma membrane; trans-Golgi network membrane; trans-Golgi network; lipid raft

Molecular Function: microtubule binding

Biological Process: peptidyl-S-palmitoyl-L-cysteine biosynthetic process from peptidyl-cysteine; fat cell differentiation; positive regulation of apoptosis; negative regulation of microtubule polymerization; positive regulation of endocytosis; positive regulation of protein amino acid phosphorylation

Research Articles on CLIP3

Similar Products

Product Notes

The CLIP3 clip3 (Catalog #AAA6130645) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CLIP3 (CLIPR59, CAP-Gly Domain-containing Linker Protein 3, Cytoplasmic Linker Protein 170-related 59kD Protein) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CLIP3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CLIP3 clip3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CLIP3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.