Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (52.25kD).)

Mouse anti-Human CLIC1 Monoclonal Antibody | anti-CLIC1 antibody

CLIC1 (Chloride Intracellular Channel Protein 1, Chloride Channel ABP, Nuclear Chloride Ion Channel 27, NCC27, Regulatory Nuclear Chloride Ion Channel Protein, hRNCC, G6, NCC27) (AP)

Gene Names
CLIC1; G6; NCC27
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CLIC1; Monoclonal Antibody; CLIC1 (Chloride Intracellular Channel Protein 1; Chloride Channel ABP; Nuclear Chloride Ion Channel 27; NCC27; Regulatory Nuclear Chloride Ion Channel Protein; hRNCC; G6; NCC27) (AP); anti-CLIC1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3F9
Specificity
Recognizes human CLIC1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-CLIC1 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 0.15ug/ml
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-241 from human CLIC1 (AAH64527.1) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MAEEQPQVELFVKAGSDGAKIGNCPFSQRLFMVLWLKGVTFNVTTVDTKRRTETVQKLCPGGQLPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPKLAALNPESNTAGLDIFAKFSAYIKNSNPALNDNLEKGLLKALKVLDNYLTSPLPEEVDETSAEDEGVSQRKFLDGNELTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFASTCPDDEEIELAYEQVAKALK
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (52.25kD).)

Western Blot (WB) (Western Blot detection against Immunogen (52.25kD).)

Western Blot (WB)

(CLIC1 monoclonal antibody, Western Blot analysis of CLIC1 expression in 293.)

Western Blot (WB) (CLIC1 monoclonal antibody, Western Blot analysis of CLIC1 expression in 293.)

Western Blot (WB)

(Western Blot analysis of CLIC1 expression in transfected 293T cell line by CLIC1 monoclonal antibody. Lane 1: CLIC1 transfected lysate (26.9kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of CLIC1 expression in transfected 293T cell line by CLIC1 monoclonal antibody. Lane 1: CLIC1 transfected lysate (26.9kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to CLIC1 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 0.15ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to CLIC1 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 0.15ug/ml])
Product Categories/Family for anti-CLIC1 antibody
References
1. Proteome dynamics during contractile and metabolic differentiation of bovine foetal muscle. Chaze T, Meunier B, Chambon C, Jurie C, Picard B.Animal (2009) doi:10.1017 /S1751731 109004315

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
26,923 Da
NCBI Official Full Name
Homo sapiens chloride intracellular channel 1, mRNA
NCBI Official Synonym Full Names
chloride intracellular channel 1
NCBI Official Symbol
CLIC1
NCBI Official Synonym Symbols
G6; NCC27
NCBI Protein Information
chloride intracellular channel protein 1

NCBI Description

Chloride channels are a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. Chloride intracellular channel 1 is a member of the p64 family; the protein localizes principally to the cell nucleus and exhibits both nuclear and plasma membrane chloride ion channel activity. [provided by RefSeq, Jul 2008]

Research Articles on CLIC1

Similar Products

Product Notes

The CLIC1 (Catalog #AAA6130641) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CLIC1 (Chloride Intracellular Channel Protein 1, Chloride Channel ABP, Nuclear Chloride Ion Channel 27, NCC27, Regulatory Nuclear Chloride Ion Channel Protein, hRNCC, G6, NCC27) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CLIC1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 0.15ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CLIC1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CLIC1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.