Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (43.05kD).)

Mouse anti-Human CLEC2D Monoclonal Antibody | anti-CLEC2D antibody

CLEC2D (CLAX, LLT1, OCIL, C-type Lectin Domain Family 2 Member D, Lectin-like NK Cell Receptor, Lectin-like Transcript 1, Osteoclast Inhibitory Lectin)

Gene Names
CLEC2D; CLAX; LLT1; OCIL
Reactivity
Human
Applications
ELISA, Western Blot, Immunohistochemistry
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
CLEC2D; Monoclonal Antibody; CLEC2D (CLAX; LLT1; OCIL; C-type Lectin Domain Family 2 Member D; Lectin-like NK Cell Receptor; Lectin-like Transcript 1; Osteoclast Inhibitory Lectin); Anti -CLEC2D (CLAX; anti-CLEC2D antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
4C7
Specificity
Recognizes human CLEC2D.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MHDSNNVEKDITPSELPANPGCVHSKEHSIKATLIWRLFFLIMFLTIIVCGMVAALSAIRANCHQEPSVCLQAACPESWIGFQRKCFYFSDDTKNWTSSQRFCDSQDADLAQVESFQELNFLLRYKGPSDHWIGLSREQGQPWKWINGTEWTRQ*
Applicable Applications for anti-CLEC2D antibody
ELISA (EL/EIA), Western Blot (WB), Immunohistochemistry (IHC)
Application Notes
Suitable for use in ELISA, Western Blot and Immunohistochemistry.
Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml
Immunogen
Full length recombinant corresponding to aa1-155 from human CLEC2D (AAH19883) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (43.05kD).)

Western Blot (WB) (Western Blot detection against Immunogen (43.05kD).)

Western Blot (WB)

(Western Blot analysis of CLEC2D expression in transfected 293T cell line by CLEC2D monoclonal antibody. Lane 1: CLEC2D transfected lysate (21.8kD).|Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of CLEC2D expression in transfected 293T cell line by CLEC2D monoclonal antibody. Lane 1: CLEC2D transfected lysate (21.8kD).|Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to CLEC2D on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to CLEC2D on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3ug/ml])
Related Product Information for anti-CLEC2D antibody
Receptor for KLRB1 that protects target cells against natural killer cell-mediated lysis. Inhibits osteoclast formation. Inhibits bone resorption. Modulates the release of interferon-gamma. Binds high molecular weight sulfated glycosaminoglycans.
Product Categories/Family for anti-CLEC2D antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
21,849 Da
NCBI Official Full Name
C-type lectin domain family 2 member D isoform 5
NCBI Official Synonym Full Names
C-type lectin domain family 2, member D
NCBI Official Symbol
CLEC2D
NCBI Official Synonym Symbols
CLAX; LLT1; OCIL
NCBI Protein Information
C-type lectin domain family 2 member D; LLT-1; C-type lectin related f; lectin-like transcript 1; lectin-like NK cell receptor; osteoclast inhibitory lectin; C-type lectin superfamily 2, member D
UniProt Protein Name
C-type lectin domain family 2 member D
UniProt Gene Name
CLEC2D
UniProt Synonym Gene Names
CLAX; LLT1; OCIL; LLT-1
UniProt Entry Name
CLC2D_HUMAN

NCBI Description

This gene encodes a member of the natural killer cell receptor C-type lectin family. The encoded protein inhibits osteoclast formation and contains a transmembrane domain near the N-terminus as well as the C-type lectin-like extracellular domain. Several alternatively spliced transcript variants have been identified for this gene. [provided by RefSeq, Oct 2010]

Uniprot Description

CLEC2D: Receptor for KLRB1 that protects target cells against natural killer cell-mediated lysis. Inhibits osteoclast formation. Inhibits bone resorption. Modulates the release of interferon- gamma. Binds high molecular weight sulfated glycosaminoglycans. 6 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 12p13

Cellular Component: cell surface; membrane; endoplasmic reticulum; integral to plasma membrane

Molecular Function: transmembrane receptor activity; carbohydrate binding

Biological Process: cell surface receptor linked signal transduction

Research Articles on CLEC2D

Similar Products

Product Notes

The CLEC2D clec2d (Catalog #AAA6008958) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CLEC2D (CLAX, LLT1, OCIL, C-type Lectin Domain Family 2 Member D, Lectin-like NK Cell Receptor, Lectin-like Transcript 1, Osteoclast Inhibitory Lectin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CLEC2D can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB), Immunohistochemistry (IHC). Suitable for use in ELISA, Western Blot and Immunohistochemistry. Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml. Researchers should empirically determine the suitability of the CLEC2D clec2d for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MHDSNNVEKD ITPSELPANP GCVHSKEHSI KATLIWRLFF LIMFLTIIVC GMVAALSAIR ANCHQEPSVC LQAACPESWI GFQRKCFYFS DDTKNWTSSQ RFCDSQDADL AQVESFQELN FLLRYKGPSD HWIGLSREQG QPWKWINGTE WTRQ*. It is sometimes possible for the material contained within the vial of "CLEC2D, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.