Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.84kD).)

Mouse anti-Human TRIM23 Monoclonal Antibody | anti-TRIM23 antibody

TRIM23 (E3 Ubiquitin-protein Ligase TRIM23, ADP-ribosylation Factor Domain-containing Protein 1, GTP-binding Protein ARD-1, RING Finger Protein 46, Tripartite Motif-containing Protein 23, ARD1, ARFD1, RNF46) (HRP)

Gene Names
TRIM23; ARD1; ARFD1; RNF46
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
TRIM23; Monoclonal Antibody; TRIM23 (E3 Ubiquitin-protein Ligase TRIM23; ADP-ribosylation Factor Domain-containing Protein 1; GTP-binding Protein ARD-1; RING Finger Protein 46; Tripartite Motif-containing Protein 23; ARD1; ARFD1; RNF46) (HRP); anti-TRIM23 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
2H4
Specificity
Recognizes human TRIM23.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-TRIM23 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-110 from human TRIM23 (AAH22510) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MATLVVNKLGAGVDSGRQGSRGTAVVKVLECGVCEDVFSLQGDKVPRLLLCGHTVCHDCLTRLPLHGRAIRCPFDRQVTDLGDSGVWGLKKNFALLELLERLQNGPIGQY
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.84kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.84kD).)

Western Blot (WB)

(TRIM23 monoclonal antibody Western Blot analysis of TRIM23 expression in A-431.)

Western Blot (WB) (TRIM23 monoclonal antibody Western Blot analysis of TRIM23 expression in A-431.)

Testing Data

(Detection limit for recombinant GST tagged TRIM23 is ~3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged TRIM23 is ~3ng/ml as a capture antibody.)
Related Product Information for anti-TRIM23 antibody
Acts as an E3 ubiquitin-protein ligase. In the presence of the human cytomegalovirus (HCMV) protein UL144, participates in 'Lys-63'-linked auto-ubiquitination of TRAF6 resulting in the virally controlled activation of NF-kappa-B at early time of infection. The C-terminus can act as an allosteric activator of the cholera toxin catalytic subunit.
Product Categories/Family for anti-TRIM23 antibody
References
1. Polyubiquitin conjugation to NEMO by triparite motif protein 23 (TRIM23) is critical in antiviral defense. Arimoto K, Funami K, Saeki Y, Tanaka K, Okawa K, Takeuchi O, Akira S, Murakami Y, Shimotohno K.Proc Natl Acad Sci U S A. 2010 Sep 7;107(36):15856-61. Epub 2010 Aug 19.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
373
Molecular Weight
61,068 Da
NCBI Official Full Name
Homo sapiens tripartite motif-containing 23, mRNA
NCBI Official Synonym Full Names
tripartite motif containing 23
NCBI Official Symbol
TRIM23
NCBI Official Synonym Symbols
ARD1; ARFD1; RNF46
NCBI Protein Information
E3 ubiquitin-protein ligase TRIM23

NCBI Description

The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This protein is also a member of the ADP ribosylation factor family of guanine nucleotide-binding family of proteins. Its carboxy terminus contains an ADP-ribosylation factor domain and a guanine nucleotide binding site, while the amino terminus contains a GTPase activating protein domain which acts on the guanine nucleotide binding site. The protein localizes to lysosomes and the Golgi apparatus. It plays a role in the formation of intracellular transport vesicles, their movement from one compartment to another, and phopholipase D activation. Three alternatively spliced transcript variants for this gene have been described. [provided by RefSeq, Jul 2008]

Research Articles on TRIM23

Similar Products

Product Notes

The TRIM23 (Catalog #AAA6155526) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The TRIM23 (E3 Ubiquitin-protein Ligase TRIM23, ADP-ribosylation Factor Domain-containing Protein 1, GTP-binding Protein ARD-1, RING Finger Protein 46, Tripartite Motif-containing Protein 23, ARD1, ARFD1, RNF46) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TRIM23 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TRIM23 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TRIM23, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.