Mouse anti-Human CLDN16 Monoclonal Antibody | anti-CLDN16 antibody

CLDN16 (PCLN1, Claudin-16, Paracellin-1, HOMG3, PCLN-1) (PE)

Cat. Num. AAA6157142

• Gene Names: CLDN16; HOMG3; PCLN1
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: CLDN16; Monoclonal Antibody; CLDN16 (PCLN1; Claudin-16; Paracellin-1; HOMG3; PCLN-1) (PE); anti-CLDN16 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 1F2
• Specificity: Recognizes human CLDN16.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-CLDN16 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa1-73 from human CLDN16 (NP_006571) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MTSRTPLLVTACLYYSYCNSRHLQQGVRKSKRPVFSHCQVPETQKTDTRHLSGARAGVCPCCHPDGLLATMRD
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (34.14kD).)

Western Blot (WB)

(Western Blot analysis of CLDN16 expression in transfected 293T cell line by CLDN16 monoclonal antibody. Lane 1: CLDN16 transfected lysate (33.8kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged CLDN16 is 0.3ng/ml as a capture antibody.)

Related Product Information for anti-CLDN16 antibody

Plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity. Involved in paracellular magnesium reabsorption. Required for a selective paracellular conductance. May form, alone or in partnership with other constituents, an intercellular pore permitting paracellular passage of magnesium and calcium ions down their electrochemical gradients. Alternatively, it could be a sensor of magnesium concentration that could alter paracellular permeability mediated by other factors.

Product Categories/Family for anti-CLDN16 antibody

Antibodies; Claudin

NCBI and Uniprot Product Information

• NCBI GI #: 5729970
• NCBI GeneID: 10686
• NCBI Accession #: NP_006571
• NCBI GenBank Nucleotide #: NM_006580
• UniProt Accession #: Q9Y5I7
• Molecular Weight: 34kDa
• NCBI Official Full Name: claudin-16
• NCBI Official Synonym Full Names: claudin 16
• NCBI Official Symbol: CLDN16
• NCBI Official Synonym Symbols: HOMG3; PCLN1
• NCBI Protein Information: claudin-16
• UniProt Protein Name: Claudin-16
• Protein Family: Claudin
• UniProt Gene Name: CLDN16
• UniProt Synonym Gene Names: PCLN1; PCLN-1

NCBI Description

Tight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets, forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space. These junctions are comprised of sets of continuous networking strands in the outwardly facing cytoplasmic leaflet, with complementary grooves in the inwardly facing extracytoplasmic leaflet. The protein encoded by this gene, a member of the claudin family, is an integral membrane protein and a component of tight junction strands. It is found primarily in the kidneys, specifically in the thick ascending limb of Henle, where it acts as either an intercellular pore or ion concentration sensor to regulate the paracellular resorption of magnesium ions. Defects in this gene are a cause of primary hypomagnesemia, which is characterized by massive renal magnesium wasting with hypomagnesemia and hypercalciuria, resulting in nephrocalcinosis and renal failure. This gene and the CLDN1 gene are clustered on chromosome 3q28. [provided by RefSeq, Jun 2010]

Uniprot Description

Plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity. Involved in paracellular magnesium reabsorption. Required for a selective paracellular conductance. May form, alone or in partnership with other constituents, an intercellular pore permitting paracellular passage of magnesium and calcium ions down their electrochemical gradients. Alternatively, it could be a sensor of magnesium concentration that could alter paracellular permeability mediated by other factors.