Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.85kD).)

Mouse anti-Human CLCA2 Monoclonal Antibody | anti-CLCA2 antibody

CLCA2 (Calcium-activated Chloride Channel Regulator 2, Calcium-activated Chloride Channel Family Member 2, hCLCA2, Calcium-activated Chloride Channel Protein 3, CaCC-3, hCaCC-3, CACC3) (AP)

Gene Names
CLCA2; CACC; CACC3; CLCRG2; CaCC-3
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CLCA2; Monoclonal Antibody; CLCA2 (Calcium-activated Chloride Channel Regulator 2; Calcium-activated Chloride Channel Family Member 2; hCLCA2; Calcium-activated Chloride Channel Protein 3; CaCC-3; hCaCC-3; CACC3) (AP); anti-CLCA2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1B9
Specificity
Recognizes human CLCA2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-CLCA2 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa300-400 from CLCA2 (NP_006527) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PTFSLVQAGDKVVCLVLDVSSKMAEADRLLQLQQAAEFYLMQIVEIHTFVGIASFDSKGEIRAQLHQINSNDDRKLLVSYLPTTVSAKTDISICSGLKKGF
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.85kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.85kD).)
Related Product Information for anti-CLCA2 antibody
Plays a role in modulating chloride current across the plasma membrane in a calcium-dependent manner, and cell adhesion. Involved in basal cell adhesion and/or stratification of squamous epithelia. May act as a tumor suppressor in breast and colorectal cancer. Plays a key role for cell adhesion in the beginning stages of lung metastasis via the binding to ITGB4.
Product Categories/Family for anti-CLCA2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
104kDa
NCBI Official Full Name
calcium-activated chloride channel regulator 2 preproprotein
NCBI Official Synonym Full Names
chloride channel accessory 2
NCBI Official Symbol
CLCA2
NCBI Official Synonym Symbols
CACC; CACC3; CLCRG2; CaCC-3
NCBI Protein Information
calcium-activated chloride channel regulator 2
UniProt Protein Name
Calcium-activated chloride channel regulator 2
UniProt Gene Name
CLCA2
UniProt Synonym Gene Names
CACC3; hCLCA2; CaCC-3; hCaCC-3
UniProt Entry Name
CLCA2_HUMAN

NCBI Description

This gene encodes a member of the calcium-activated chloride channel regulator (CLCR) family of proteins. Members of this family regulate the transport of chloride across the plasma membrane. The encoded protein is autoproteolytically processed to generate N- and C- terminal fragments. Expression of this gene is upregulated by the tumor suppressor protein p53 in response to DNA damage. In breast cancer, expression of this gene is downregulated and the encoded protein may inhibit migration and invasion while promoting mesenchymal-to-epithelial transition in cancer cell lines. [provided by RefSeq, Sep 2016]

Uniprot Description

Function: Plays a role in modulating chloride current across the plasma membrane in a calcium-dependent manner, and cell adhesion. Involved in basal cell adhesion and/or stratification of squamous epithelia. May act as a tumor suppressor in breast and colorectal cancer. Plays a key role for cell adhesion in the beginning stages of lung metastasis via the binding to ITGB4. Ref.7 Ref.8 Ref.9 Ref.11 Ref.12

Subcellular location: Cell membrane; Single-pass type I membrane protein. Basal cell membrane; Single-pass type I membrane protein. Cell junction Ref.1 Ref.10 Ref.11 Ref.13. Calcium-activated chloride channel regulator 2, 109 kDa form: Secreted. Note: Remains associated to the 35 kDa form until an unidentified event triggers the release. Ref.1 Ref.10 Ref.11 Ref.13

Tissue specificity: Expressed in cornea, skin, vagina, esophagus, and larynx (at protein level). Expressed in trachea and mammary gland. Weakly expressed in testis and kidney. Highly expressed in corneal epithelium, colon and trachea. Moderately expressed in brain, urogenital organs, bladder, uterus and prostate. Highly expressed in tissues containing stratified epithelium including cornea, esophagus, larynx, skin and vagina than those tissues which contain only epithelial monolayers. Expressed in normal breast epithelium but not in breast cancer. Highly expressed during epithelial stratification. Expressed in endothelial cells of lung. Expressed selectively in endothelia of small pulmonary arteries, arterioles, and subpleural and interlobular venules. Ref.1 Ref.2 Ref.3 Ref.7 Ref.9 Ref.10 Ref.11 Ref.12

Induction: Significantly down-regulated in breast and colorectal cancer. Ref.7 Ref.8

Post-translational modification: The 141 kDa mature form is shedded, producing a 109 kDa form and a 35 kDa form.N-glycosylated. Ref.1 Ref.13

Sequence similarities: Belongs to the CLCR family.Contains 1 VWFA domain.

Research Articles on CLCA2

Similar Products

Product Notes

The CLCA2 clca2 (Catalog #AAA6130621) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CLCA2 (Calcium-activated Chloride Channel Regulator 2, Calcium-activated Chloride Channel Family Member 2, hCLCA2, Calcium-activated Chloride Channel Protein 3, CaCC-3, hCaCC-3, CACC3) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CLCA2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CLCA2 clca2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CLCA2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.