Mouse anti-Human CHST5 Monoclonal Antibody | anti-Chst5 antibody

CHST5 (Carbohydrate sulfotransferase 5, Galactose/N-acetylglucosamine/N-acetylglucosamine 6-O-sulfotransferase 4-alpha, Intestinal N-acetylglucosamine-6-O-sulfotransferase, N-acetylglucosamine 6-O-sulfotransferase 3)

Cat. Num. AAA6005060

• Gene Names: Chst5; GST-4; Gn6st-3; AI173964; I-GlcNAc-6-ST
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: CHST5; Monoclonal Antibody; CHST5 (Carbohydrate sulfotransferase 5; Galactose/N-acetylglucosamine/N-acetylglucosamine 6-O-sulfotransferase 4-alpha; Intestinal N-acetylglucosamine-6-O-sulfotransferase; N-acetylglucosamine 6-O-sulfotransferase 3); Anti -CHST5 (Carbohydrate sulfotransferase 5; anti-Chst5 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 2E6
• Specificity: Recognizes human CHST5.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: GSGIGKPIEAFHTSSRNARNVSQAWRHALPFTKILRVQEVCAGALQLLGYRPVYSADQQRDLTLDLVLPRGPDHFSWASPD*

• Applicable Applications for anti-Chst5 antibody: ELISA (EL/EIA), Western Blot (WB)
• Application Notes: Suitable for use in ELISA and Western Blot.
• Immunogen: Partial recombinant corresponding to aa310-391 from CHST5 (NP_036258) with GST tag. MW of the GST tag alone is 26kD.
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (35.02kD).)

Testing Data

(Detection limit for recombinant GST tagged CHST5 is 0.1ng/ml as a capture antibody.)

Related Product Information for anti-Chst5 antibody

The carbohydrates of glycoconjugates are highly diverse structures with variation in monosaccharide composition, glycosidic linkage positions, and branching of chains. Further diversity is added by the covalent addition of sulfate moieties to particular hydroxyl groups and amino groups of saccharides. The sulfate modifications of glycoproteins can be extensive in amount and frequently occur at high density. They can have a profound effect on the physiochemical properties of the glycoconjugates, at least in part through the addition of negative charge. Carbohydrate sulfation plays a critical role in many biologic processes. CHST5 belongs to the GST family of sulfotransferases, which also includes CHST1 (MIM 603797), CHST2 (MIM 603798), CHST3 (MIM 603799), and LSST. These enzymes are 6-O-sulfotransferases, which add sulfate to C6 of galactose (Gal), N-acetylgalactosamine (GalNAc), or N-acetylglucosamine (GlcNAc) (Lee et al., 1999 [PubMed 10491328]).

Product Categories/Family for anti-Chst5 antibody

Antibodies; Abs to Enzymes; Sulfotransferase

NCBI and Uniprot Product Information

• NCBI GI #: 9910284
• NCBI GeneID: 56773
• NCBI Accession #: NP_064334.1
• NCBI GenBank Nucleotide #: NM_019950.2
• UniProt Accession #: Q9QUP4
• Molecular Weight: 44,537 Da
• NCBI Official Full Name: carbohydrate sulfotransferase 5
• NCBI Official Synonym Full Names: carbohydrate (N-acetylglucosamine 6-O) sulfotransferase 5
• NCBI Official Symbol: Chst5
• NCBI Official Synonym Symbols: GST-4; Gn6st-3; AI173964; I-GlcNAc-6-ST
• NCBI Protein Information: carbohydrate sulfotransferase 5; GST4; mIGn6ST; I-GlcNAc6ST; glcNAc6ST-3; intestinal GlcNAc-6-sulfotransferase; N-acetylglucosamine 6-O-sulfotransferase 3; intestinal N-acetylglucosamine-6-O-sulfotransferase; galactose/N-acetylglucosamine/N-acetylglucosamine 6-O-sulfotransferase 4
• UniProt Protein Name: Carbohydrate sulfotransferase 5
• Protein Family: Carbohydrate sulfotransferase
• UniProt Gene Name: Chst5
• UniProt Synonym Gene Names: Gst4; GST4; I-GlcNAc6ST; Intestinal GlcNAc-6-sulfotransferase; mIGn6ST; GlcNAc6ST-3; Gn6st-3
• UniProt Entry Name: CHST5_MOUSE

Uniprot Description

CHST6: Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the transfer of sulfate to position 6 of non-reducing N-acetylglucosamine (GlcNAc) residues of keratan. Mediates sulfation of keratan in cornea. Keratan sulfate plays a central role in maintaining corneal transparency. Acts on the non-reducing terminal GlcNAc of short and long carbohydrate substrates that have poly-N- acetyllactosamine structures. Defects in CHST6 are the cause of macular corneal dystrophy (MCD). MCD is an autosomal recessive disease characterized by corneal opacities. Onset occurs in the first decade, usually between ages 5 and 9. The disorder is progressive. Minute, gray, punctate opacities develop. Corneal sensitivity is usually reduced. Painful attacks with photophobia, foreign body sensations, and recurrent erosions occur in most patients. There are different types of MCD: MCD type I, in which there is a virtual absence of sulfated keratan sulfate (KS) in the serum and cornea, as determined by KS-specific antibodies; and MCD type II, in which the normal sulfated KS-antibody response is present in cornea and serum. MCD type I patients usually have a homozygous missense mutation, while MCD type II patients show a large deletion and replacement in the upstream region of CHST6. The only missense mutation for type II is Cys-50, which is heterozygous with a replacement in the upstream region on the other allele of CHST6. Belongs to the sulfotransferase 1 family. Gal/GlcNAc/GalNAc subfamily.

Protein type: EC 2.8.2.-; Membrane protein, integral; Glycan Metabolism - keratan sulfate biosynthesis; Transferase

Cellular Component: Golgi membrane; Golgi apparatus; membrane; integral to membrane

Molecular Function: phenanthrol sulfotransferase activity; trans-3,4-dihydrodiolphenanthrene sulfotransferase activity; proteoglycan sulfotransferase activity; 2-phenanthrol sulfotransferase activity; galactose 3-O-sulfotransferase activity; 1-phenanthrol sulfotransferase activity; transferase activity; sulfotransferase activity; 3-phenanthrol sulfotransferase activity; N-acetylglucosamine 6-O-sulfotransferase activity; HNK-1 sulfotransferase activity; 4-phenanthrol sulfotransferase activity; trans-9R,10R-dihydrodiolphenanthrene sulfotransferase activity; heparan sulfate 2-O-sulfotransferase activity; cholesterol sulfotransferase activity; N-acetylgalactosamine 4-O-sulfotransferase activity; 9-phenanthrol sulfotransferase activity; heparan sulfate 6-O-sulfotransferase activity

Biological Process: sulfur metabolic process; N-acetylglucosamine metabolic process; carbohydrate metabolic process; keratan sulfate biosynthetic process