Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD))

Mouse anti-Human CHST3 Monoclonal Antibody | anti-CHST3 antibody

CHST3 (Carbohydrate sulfotransferase 3, Chondroitin 6-O-sulfotransferase 1, Chondroitin 6-sulfotransferase, Galactose/N-acetylglucosamine/N-acetylglucosamine 6-O-sulfotransferase 0) APC

Gene Names
CHST3; HSD; C6ST; C6ST1
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CHST3; Monoclonal Antibody; CHST3 (Carbohydrate sulfotransferase 3; Chondroitin 6-O-sulfotransferase 1; Chondroitin 6-sulfotransferase; Galactose/N-acetylglucosamine/N-acetylglucosamine 6-O-sulfotransferase 0) APC; anti-CHST3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1C4
Specificity
Recognizes human CHST3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Sequence Length
6934
Applicable Applications for anti-CHST3 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa312-411 from CHST3 (NP_004264) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
VAFAGKYKTWKKWLDDEGQDGLREEEVQRLRGNCESIRLSAELGLRQPAWLRGRYMLVRYEDVARGPLQKAREMYRFAGIPLTPQVEDWIQKNTQAAHDG
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD))

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD))

Western Blot (WB)

(CHST3 monoclonal antibody Western Blot analysis of CHST3 expression in Hela NE)

Western Blot (WB) (CHST3 monoclonal antibody Western Blot analysis of CHST3 expression in Hela NE)

Testing Data

(Detection limit for recombinant GST tagged CHST3 is ~0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged CHST3 is ~0.3ng/ml as a capture antibody.)
Related Product Information for anti-CHST3 antibody
CHST3 is an enzyme which catalyzes the sulfation of chondroitin, a proteoglycan found in the extracellular matrix and most cells which is involved in cell migration and differentiation.
Product Categories/Family for anti-CHST3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens carbohydrate sulfotransferase 3 (CHST3), mRNA
NCBI Official Synonym Full Names
carbohydrate sulfotransferase 3
NCBI Official Symbol
CHST3
NCBI Official Synonym Symbols
HSD; C6ST; C6ST1
NCBI Protein Information
carbohydrate sulfotransferase 3
UniProt Protein Name
Carbohydrate sulfotransferase 3
UniProt Gene Name
CHST3
UniProt Synonym Gene Names
C6ST-1; GST-0

NCBI Description

This gene encodes an enzyme which catalyzes the sulfation of chondroitin, a proteoglycan found in the extracellular matrix and most cells which is involved in cell migration and differentiation. Mutations in this gene are associated with spondylepiphyseal dysplasia and humerospinal dysostosis. [provided by RefSeq, Mar 2009]

Uniprot Description

Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the transfer of sulfate to position 6 of the N-acetylgalactosamine (GalNAc) residue of chondroitin. Chondroitin sulfate constitutes the predominant proteoglycan present in cartilage and is distributed on the surfaces of many cells and extracellular matrices. Can also sulfate Gal residues of keratan sulfate, another glycosaminoglycan, and the Gal residues in sialyl N-acetyllactosamine (sialyl LacNAc) oligosaccharides. May play a role in the maintenance of naive T-lymphocytes in the spleen.

Research Articles on CHST3

Similar Products

Product Notes

The CHST3 chst3 (Catalog #AAA6135898) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CHST3 (Carbohydrate sulfotransferase 3, Chondroitin 6-O-sulfotransferase 1, Chondroitin 6-sulfotransferase, Galactose/N-acetylglucosamine/N-acetylglucosamine 6-O-sulfotransferase 0) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CHST3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CHST3 chst3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CHST3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.