SDS-PAGE
Eukaryotic translation initiation factor 1 Recombinant Protein | EIF1 recombinant protein
Recombinant Human Eukaryotic translation initiation factor 1 protein
Gene Names
EIF1; A121; ISO1; SUI1; EIF-1; EIF1A
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Eukaryotic translation initiation factor 1; Recombinant Human Eukaryotic translation initiation factor 1 protein; A121; Protein translation factor SUI1 homolog; Sui1iso1; EIF1 recombinant protein
Host
E Coli
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-113aa; Full Length
Sequence
MSAIQNLHSFDPFADASKGDDLLPAGTEDYIHIRIQQRNGRKTLTTVQGIADDYDKKKLVKAFKKKFACNGTVIEHPEYGEVIQLQGDQRKNICQFLVEIGLAKDDQLKVHGF
Sequence Length
113
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
SDS-PAGE
SDS-PAGE
Related Product Information for EIF1 recombinant protein
Necessary for scanning and involved in initiation site selection. Promotes the assembly of 48S ribosomal complexes at the authentic initiation codon of a conventional capped mRNA.
Product Categories/Family for EIF1 recombinant protein
References
Expressed sequence tags identify a human isolog of the suil translation initiation factor.Fields C.A., Adams M.D.Biochem. Biophys. Res. Commun. 198:288-291(1994)
Okadaic acid-responsive genes in malignant glioma cells identified by mRNA differential display.Singh S.K., Murray S.F., Chin L.S. Cloning and characterization of a human genotoxic and endoplasmic reticulum stress-inducible cDNA that encodes translation initiation factor 1 (eIF1(A121/SUI1)
)
.Sheikh M.S., Fernandez-Salas E., Yu M., Hussain A., Dinman J.D., Peltz S.W., Huang Y., Fornace A.J. Jr.J. Biol. Chem. 274:16487-16493(1999)
Novel Upf2p orthologues suggest a functional link between translation initiation and nonsense surveillance complexes.Mendell J.T., Medghalchi S.M., Lake R.G., Noensie E.N., Dietz H.C.Mol. Cell. Biol. 20:8944-8957(2000)
Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.Anal. Chem. 81:4493-4501(2009)
Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.Sci. Signal. 3:RA3-RA3(2010)
System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.Sci. Signal. 4:RS3-RS3(2011)
Structure and interactions of the translation initiation factor eIF1.Fletcher C.M., Pestova T.V., Hellen C.U., Wagner G.EMBO J. 18:2631-2637(1999)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
39.7 kDa
NCBI Official Full Name
eukaryotic translation initiation factor 1
NCBI Official Synonym Full Names
eukaryotic translation initiation factor 1
NCBI Official Symbol
EIF1
NCBI Official Synonym Symbols
A121; ISO1; SUI1; EIF-1; EIF1A
NCBI Protein Information
eukaryotic translation initiation factor 1
UniProt Protein Name
Eukaryotic translation initiation factor 1
Protein Family
UniProt Gene Name
EIF1
UniProt Synonym Gene Names
SUI1; eIF1
UniProt Entry Name
EIF1_HUMAN
Uniprot Description
EIF1: a translation initiation factor. Necessary for scanning and involved in initiation site selection. Promotes the assembly of 48S ribosomal complexes at the authentic initiation codon of a conventional capped mRNA.
Protein type: Translation initiation; Translation
Chromosomal Location of Human Ortholog: 17q21.2
Cellular Component: cytoplasm; nucleus
Molecular Function: translation factor activity, nucleic acid binding; translation initiation factor activity
Biological Process: dosage compensation, by inactivation of X chromosome; regulation of translational initiation; response to stress; translational initiation
Research Articles on EIF1
Similar Products
Product Notes
The EIF1 eif1 (Catalog #AAA717314) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-113aa; Full Length. The amino acid sequence is listed below: MSAIQNLHSF DPFADASKGD DLLPAGTEDY IHIRIQQRNG RKTLTTVQGI ADDYDKKKLV KAFKKKFACN GTVIEHPEYG EVIQLQGDQR KNICQFLVEI GLAKDDQLKV HGF. It is sometimes possible for the material contained within the vial of "Eukaryotic translation initiation factor 1, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
