Mouse anti-Human CHEK1 Monoclonal Antibody | anti-CHEK1 antibody

CHEK1 (Serine/Threonine-protein Kinase Chk1, CHK1 Checkpoint Homolog, Cell Cycle Checkpoint Kinase, Checkpoint Kinase-1, CHK1) (FITC)

Cat. Num. AAA6146482

• Gene Names: CHEK1; CHK1
• Reactivity: Human
• Applications: ELISA, Immunofluorescence
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: CHEK1; Monoclonal Antibody; CHEK1 (Serine/Threonine-protein Kinase Chk1; CHK1 Checkpoint Homolog; Cell Cycle Checkpoint Kinase; Checkpoint Kinase-1; CHK1) (FITC); anti-CHEK1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 2G3
• Specificity: Recognizes human CHEK1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
• Sequence Length: 1893

• Applicable Applications for anti-CHEK1 antibody: ELISA (EIA), Immunofluorescence (IF)
• Application Notes: IF: 10ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa361-476 from human CHEK1 (AAH04202) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: GTPGSSQNPWQRLVKRMTRFFTKLDADKSYQCLKETCEKLGYQWKKSCMNQVTISTTDRRNNKLIFKVNLLEMDDKILVDFRLSKGDGLEFKRHFLKIKGKLIDIVSSQKVWLPAT
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to CHEK1 on HeLa cell. [antibody concentration 10ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged CHEK1 is ~1ng/ml as a capture antibody.)

Product Categories/Family for anti-CHEK1 antibody

Antibodies; Cancer Markers

NCBI and Uniprot Product Information

• NCBI GI #: 33990929
• NCBI GeneID: 1111
• NCBI Official Full Name: Homo sapiens CHK1 checkpoint homolog (S. pombe), mRNA
• NCBI Official Synonym Full Names: checkpoint kinase 1
• NCBI Official Symbol: CHEK1
• NCBI Official Synonym Symbols: CHK1
• NCBI Protein Information: serine/threonine-protein kinase Chk1

NCBI Description

The protein encoded by this gene belongs to the Ser/Thr protein kinase family. It is required for checkpoint mediated cell cycle arrest in response to DNA damage or the presence of unreplicated DNA. This protein acts to integrate signals from ATM and ATR, two cell cycle proteins involved in DNA damage responses, that also associate with chromatin in meiotic prophase I. Phosphorylation of CDC25A protein phosphatase by this protein is required for cells to delay cell cycle progression in response to double-strand DNA breaks. Several alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Oct 2011]