CD344 recombinant protein

CD344 Recombinant Protein

Cat. Num. AAA3004267

• Gene Names: FZD4; Fz4; EVR1; FEVR; Fz-4; FzE4; GPCR; hFz4; CD344; FZD4S
• Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is >85% (by SDS-PAGE).
• Synonyms: CD344; CD344 Recombinant Protein; CD344 recombinant protein

• Host: E Coli
• Purity/Purification: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is >85% (by SDS-PAGE).
• Form/Format: PBS, 4M Urea, PH7.4
• Concentration: >=0.5mg/ml (varies by lot)
• Sequence: FGDEEERRCDPIRISMCQNLGYNVTKMPNLVGHELQTDAELQLTTFTPLIQYGCSSQLQFFLCSVYVPMCTEKINIPIGPCGGMCLSVKRRCEPVLKEFGFAWPESLNCSKFPPQNDHNHMCMEGPGDEEVPLPHKTPIQPGEECHSVGTNSDQYIWVKRSLNCVLKCGYDAGLYS

• Tag: His-tag in C-terminal
• Expression Vector: pet-22b(+)
• BP: 540
• Restriction Site: NdeI-XhoI
• Preparation and Storage: Store at 4 degee C for short term. Aliquot and store at -20 degee C long term. Avoid freeze-thaw cycles.

Testing Data

()

Related Product Information for CD344 recombinant protein

Background: Frizzled-4 is a 537 amino acid protein encoded by the human gene FZD4. Frizzled-4 acts as a receptor for Wnt proteins. Most frizzled receptors are coupled to the b-catenin canonical signaling pathway, which leads to the activation of disheveled proteins, inhibition of GSK-3 kinase, nuclear accumulation of b-catenin and activation of Wnt target genes. A second signaling pathway involving PKC and calcium fluxes has been seen for some family members, but it is not yet clear if it represents a distinct pathway or if it can be integrated in the canonical pathway, as PKC seems to be required for Wnt-mediated inactivation of GSK-3 kinase. Both pathways seem to involve interactions with G-proteins. Frizzled-4 may be involved in transduction and intercellular transmission of polarity information during tissue morphogenesis and/or in differentiated tissues. Frizzled-4 also plays a critical role in retinal angiogenesis. Frizzled-4 is virtually ubiquitously expressed with greatest amounts found in adult heart, skeletal muscle, ovary, and fetal kidney

NCBI and Uniprot Product Information

• NCBI GI #: 22547161
• NCBI GeneID: 8322
• NCBI Accession #: NP_036325.2
• NCBI GenBank Nucleotide #: NM_012193.3
• UniProt Accession #: Q9ULV1; Q14C97; Q6S9E4; A8K9Q3
• Molecular Weight: 59,881 Da
• NCBI Official Full Name: frizzled-4
• NCBI Official Synonym Full Names: frizzled family receptor 4
• NCBI Official Symbol: FZD4
• NCBI Official Synonym Symbols: Fz4; EVR1; FEVR; Fz-4; FzE4; GPCR; hFz4; CD344; FZD4S
• NCBI Protein Information: frizzled-4; frizzled homolog 4; WNT receptor frizzled-4; frizzled 4, seven transmembrane spanning receptor
• UniProt Protein Name: Frizzled-4
• UniProt Gene Name: FZD4
• UniProt Synonym Gene Names: Fz-4; hFz4
• UniProt Entry Name: FZD4_HUMAN

NCBI Description

This gene is a member of the frizzled gene family. Members of this family encode seven-transmembrane domain proteins that are receptors for the Wingless type MMTV integration site family of signaling proteins. Most frizzled receptors are coupled to the beta-catenin canonical signaling pathway. This protein may play a role as a positive regulator of the Wingless type MMTV integration site signaling pathway. A transcript variant retaining intronic sequence and encoding a shorter isoform has been described, however, its expression is not supported by other experimental evidence. [provided by RefSeq, Jul 2008]

Uniprot Description

FZD4: Receptor for Wnt proteins. Most of frizzled receptors are coupled to the beta-catenin (CTNNB1) canonical signaling pathway, which leads to the activation of disheveled proteins, inhibition of GSK-3 kinase, nuclear accumulation of beta-catenin (CTNNB1) and activation of Wnt target genes. Plays a critical role in retinal vascularization by acting as a receptor for Wnt proteins and norrin (NDP). In retina, it can be both activated by Wnt protein-binding, but also by a Wnt-independent signaling via binding of norrin (NDP), promoting in both cases beta-catenin (CTNNB1) accumulation and stimulation of LEF/TCF-mediated transcriptional programs. A second signaling pathway involving PKC and calcium fluxes has been seen for some family members, but it is not yet clear if it represents a distinct pathway or if it can be integrated in the canonical pathway, as PKC seems to be required for Wnt-mediated inactivation of GSK-3 kinase. Both pathways seem to involve interactions with G-proteins. May be involved in transduction and intercellular transmission of polarity information during tissue morphogenesis and/or in differentiated tissues. Defects in FZD4 are the cause of vitreoretinopathy exudative type 1 (EVR1); also known as autosomal dominant familial exudative vitreoretinopathy (FEVR) or Criswick- Schepens syndrome. EVR1 is a disorder of the retinal vasculature characterized by an abrupt cessation of growth of peripheral capillaries, leading to an avascular peripheral retina. This may lead to compensatory retinal neovascularization, which is thought to be induced by hypoxia from the initial avascular insult. New vessels are prone to leakage and rupture causing exudates and bleeding, followed by scarring, retinal detachment and blindness. Clinical features can be highly variable, even within the same family. Patients with mild forms of the disease are asymptomatic, and their only disease-related abnormality is an arc of avascular retina in the extreme temporal periphery. Belongs to the G-protein coupled receptor Fz/Smo family.

Protein type: Membrane protein, multi-pass; Receptor, GPCR; Membrane protein, integral; GPCR, Fz/Smo family

Chromosomal Location of Human Ortholog: 11q14.2

Cellular Component: cell surface; integral to plasma membrane; integral to membrane; plasma membrane; intercellular junction

Molecular Function: G-protein coupled receptor activity; Wnt-protein binding; Wnt receptor activity; protein binding; protein homodimerization activity; protein heterodimerization activity; cytokine binding; ubiquitin protein ligase binding; PDZ domain binding

Biological Process: positive regulation of JNK activity; Wnt receptor signaling pathway; positive regulation of transcription, DNA-dependent; Wnt receptor signaling pathway through beta-catenin; progesterone secretion; locomotion during locomotory behavior; neuron differentiation; G-protein coupled receptor protein signaling pathway; Wnt receptor signaling pathway, calcium modulating pathway; sensory perception of sound; regulation of vascular endothelial growth factor receptor signaling pathway; positive regulation of transcription factor activity; vasculogenesis

Disease: Exudative Vitreoretinopathy 1