Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.3kD).)

Mouse anti-Human CHD1 Monoclonal Antibody | anti-CHD1 antibody

CHD1 (Chromodomain-helicase-DNA-binding Protein 1, CHD-1, ATP-dependent Helicase CHD1) (FITC)

Gene Names
CHD1; CHD-1; PILBOS
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CHD1; Monoclonal Antibody; CHD1 (Chromodomain-helicase-DNA-binding Protein 1; CHD-1; ATP-dependent Helicase CHD1) (FITC); anti-CHD1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
1G2
Specificity
Recognizes human CHD1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-CHD1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1177-1272 from human CHD1 (NP_001261) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
IKALKDSSSGTERTGGRLGKVKGPTFRISGVQVNAKLVISHEEELIPLHKSIPSDPEERKQYTIPCHTKAAHFDIDWGKEDDSNLLIGIYEYGYGS
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.3kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.3kD).)

Testing Data

(Detection limit for recombinant GST tagged CHD1 is 0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged CHD1 is 0.3ng/ml as a capture antibody.)
Related Product Information for anti-CHD1 antibody
The CHD family of proteins is characterized by the presence of chromo (chromatin organization modifier) domains and SNF2-related helicase/ATPase domains. CHD genes alter gene expression possibly by modification of chromatin structure thus altering access of the transcriptional apparatus to its chromosomal DNA template.
Product Categories/Family for anti-CHD1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
197kDa
NCBI Official Full Name
chromodomain-helicase-DNA-binding protein 1 isoform 2
NCBI Official Synonym Full Names
chromodomain helicase DNA binding protein 1
NCBI Official Symbol
CHD1
NCBI Official Synonym Symbols
CHD-1; PILBOS
NCBI Protein Information
chromodomain-helicase-DNA-binding protein 1
UniProt Protein Name
Chromodomain-helicase-DNA-binding protein 1
UniProt Gene Name
CHD1
UniProt Synonym Gene Names
CHD-1
UniProt Entry Name
CHD1_HUMAN

NCBI Description

The CHD family of proteins is characterized by the presence of chromo (chromatin organization modifier) domains and SNF2-related helicase/ATPase domains. CHD genes alter gene expression possibly by modification of chromatin structure thus altering access of the transcriptional apparatus to its chromosomal DNA template. [provided by RefSeq, Jul 2008]

Uniprot Description

CHD-1: a sequence-selective DNA-binding protein. Contains two chromo (chromatin organization modifier) domains and one SNF2-related helicase and ATPase domains. May play an important role in gene regulation.

Protein type: Helicase; EC 3.6.4.12

Chromosomal Location of Human Ortholog: 5q15-q21

Cellular Component: cytoplasm; nucleus

Molecular Function: ATP-dependent DNA helicase activity; protein binding; DNA binding; methylated histone residue binding; ATP binding

Biological Process: chromatin remodeling; regulation of transcription from RNA polymerase II promoter; transcription, DNA-dependent; DNA duplex unwinding

Research Articles on CHD1

Similar Products

Product Notes

The CHD1 chd1 (Catalog #AAA6146479) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CHD1 (Chromodomain-helicase-DNA-binding Protein 1, CHD-1, ATP-dependent Helicase CHD1) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CHD1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CHD1 chd1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CHD1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.