Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human CELSR3 Monoclonal Antibody | anti-CELSR3 antibody

CELSR3 (Cadherin EGF LAG Seven-pass G-type Receptor 3, Cadherin Family Member 11, CDHF11, Epidermal Growth Factor-like Protein 1, EGF-like Protein 1, EGFL1, Flamingo Homolog 1, FMI1, hFmi1, KIAA0812, MEGF2, Multiple Epidermal Growth Factor-like Domains Pr

Gene Names
CELSR3; FMI1; EGFL1; HFMI1; MEGF2; ADGRC3; CDHF11; RESDA1
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CELSR3; Monoclonal Antibody; CELSR3 (Cadherin EGF LAG Seven-pass G-type Receptor 3; Cadherin Family Member 11; CDHF11; Epidermal Growth Factor-like Protein 1; EGF-like Protein 1; EGFL1; Flamingo Homolog 1; FMI1; hFmi1; KIAA0812; MEGF2; Multiple Epidermal Growth Factor-like Domains Pr; anti-CELSR3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2F7
Specificity
Recognizes human CELSR3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight490.
Sequence Length
3312
Applicable Applications for anti-CELSR3 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa71-180 from human CELSR3 (NP_001398) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
REDGGPGLGVREPIFVGLRGRRQSARNSRGPPEQPNEELGIEHGVQPLGSRERETGQGPGSVLYWRPEVSSCGRTGPLQRGSLSPGALSSGVPGSGNSSPLPSDFLIRHH
Conjugate
MaxLight490
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-CELSR3 antibody
CELSR3 is an Orphan-U GPCR with an unknown ligand. In mouse, this gene is expressed during development at sites of active neurogenesis and in adult mice and rats in brain, spinal cord, dorsal root ganglion, and eye. ESTs have been isolated from human B-cell/lung/testis, blood, brain, colon, heart/melanocyte/uterus, lung, nerve, and placenta libraries.
Product Categories/Family for anti-CELSR3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
cadherin EGF LAG seven-pass G-type receptor 3
NCBI Official Synonym Full Names
cadherin EGF LAG seven-pass G-type receptor 3
NCBI Official Symbol
CELSR3
NCBI Official Synonym Symbols
FMI1; EGFL1; HFMI1; MEGF2; ADGRC3; CDHF11; RESDA1
NCBI Protein Information
cadherin EGF LAG seven-pass G-type receptor 3
UniProt Protein Name
Cadherin EGF LAG seven-pass G-type receptor 3
UniProt Gene Name
CELSR3
UniProt Synonym Gene Names
CDHF11; EGFL1; FMI1; KIAA0812; MEGF2; EGF-like protein 1; hFmi1
UniProt Entry Name
CELR3_HUMAN

NCBI Description

This gene belongs to the flamingo subfamily, which is included in the cadherin superfamily. The flamingo cadherins consist of nonclassic-type cadherins that do not interact with catenins. They are plasma membrane proteins containing seven epidermal growth factor-like repeats, nine cadherin domains and two laminin A G-type repeats in their ectodomain. They also have seven transmembrane domains, a characteristic feature of their subfamily. The encoded protein may be involved in the regulation of contact-dependent neurite growth and may play a role in tumor formation. [provided by RefSeq, Jun 2013]

Uniprot Description

CELSR3: Receptor that may have an important role in cell/cell signaling during nervous system formation. Belongs to the G-protein coupled receptor 2 family. LN-TM7 subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Receptor, GPCR; Membrane protein, multi-pass; GPCR, family 2

Chromosomal Location of Human Ortholog: 3p21.31

Cellular Component: integral to membrane; plasma membrane

Molecular Function: G-protein coupled receptor activity; protein binding; calcium ion binding

Biological Process: G-protein coupled receptor protein signaling pathway; regulation of protein localization; axonal fasciculation; neuron migration; cilium biogenesis; homophilic cell adhesion

Research Articles on CELSR3

Similar Products

Product Notes

The CELSR3 celsr3 (Catalog #AAA6200080) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CELSR3 (Cadherin EGF LAG Seven-pass G-type Receptor 3, Cadherin Family Member 11, CDHF11, Epidermal Growth Factor-like Protein 1, EGF-like Protein 1, EGFL1, Flamingo Homolog 1, FMI1, hFmi1, KIAA0812, MEGF2, Multiple Epidermal Growth Factor-like Domains Pr reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CELSR3 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CELSR3 celsr3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CELSR3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.