Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (56.65kD).)

Mouse anti-Human CEBPE Monoclonal Antibody | anti-CEBPE antibody

CEBPE (CCAAT/Enhancer-binding Protein epsilon, C/EBP epsilon) (HRP)

Gene Names
CEBPE; CRP1; C/EBP-epsilon
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CEBPE; Monoclonal Antibody; CEBPE (CCAAT/Enhancer-binding Protein epsilon; C/EBP epsilon) (HRP); anti-CEBPE antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
7A4
Specificity
Recognizes human CEBPE.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-CEBPE antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-281 from human CEBPE (AAH35797.2) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MSHGTYYECEPRGGQQPLEFSGGRAGPGELGDMCEHEASIDLSAYIESGEEQLLSDLFAVKPAPEARGLKGPGTPAFPHYLPPDPRPFAYPPHTFGPDRKALGPGIYSSPGSYDPRAVAVKEEPRGPEGSRAASRGSYNPLQYQVAHCGQTAMHLPPTLAAPGQPLRVLKAPLATAAPPCSPLLKAPSP AGPLHKGKKAVNKDSLEYRLRRERNNIAVRKSRDKAKRRILETQQKVLEYMAENERLRSRVEQLTQELDTLRNLFRQIPEAANLIKGVGGCS
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (56.65kD).)

Western Blot (WB) (Western Blot detection against Immunogen (56.65kD).)

Western Blot (WB)

(Western Blot analysis of CEBPE expression in transfected 293T cell line by CEBPE monoclonal antibody. Lane 1: CEBPE transfected lysate (30.6kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of CEBPE expression in transfected 293T cell line by CEBPE monoclonal antibody. Lane 1: CEBPE transfected lysate (30.6kD). Lane 2: Non-transfected lysate.)

Western Blot (WB)

(Western blot analysis of CEBPE over-expressed 293 cell line, cotransfected with CEBPE Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with CEBPE monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Western Blot (WB) (Western blot analysis of CEBPE over-expressed 293 cell line, cotransfected with CEBPE Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with CEBPE monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)
Related Product Information for anti-CEBPE antibody
CCAAT-enhancer binding protein epsilon (CEBP e) is a 32kD basic-leucine zipper transcription factor that is expressed in myeloblasts, granulocytes, and eosinophils. Multiple isoforms of human CEBP e are generated by alternate splicing and alternative translation initiation sites. All four isoforms contain the bZIP domain (aa208-267) but exert different effects on myeloid differentiation. Full length CEBP e and the 30kD isoform (aa33-281) cooperate with c-Myb to activate the transcription of genes involved in myeloid differentiation. The 27kD isoform (which lacks aa69-97) and the 14kD isoform (which begins at aa153) function as transcriptional repressors in eosinophils. Within aa151-210, human CEBP e shares 93aa sequence identity with mouse and rat CEBP e, respectively.
Product Categories/Family for anti-CEBPE antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
30,603 Da
NCBI Official Full Name
Homo sapiens CCAAT/enhancer binding protein (C/EBP), epsilon, mRNA
NCBI Official Synonym Full Names
CCAAT/enhancer binding protein epsilon
NCBI Official Symbol
CEBPE
NCBI Official Synonym Symbols
CRP1; C/EBP-epsilon
NCBI Protein Information
CCAAT/enhancer-binding protein epsilon

NCBI Description

The protein encoded by this gene is a bZIP transcription factor which can bind as a homodimer to certain DNA regulatory regions. It can also form heterodimers with the related protein CEBP-delta. The encoded protein may be essential for terminal differentiation and functional maturation of committed granulocyte progenitor cells. Mutations in this gene have been associated with Specific Granule Deficiency, a rare congenital disorder. Multiple variants of this gene have been described, but the full-length nature of only one has been determined. [provided by RefSeq, Jul 2008]

Research Articles on CEBPE

Similar Products

Product Notes

The CEBPE (Catalog #AAA6151748) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CEBPE (CCAAT/Enhancer-binding Protein epsilon, C/EBP epsilon) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CEBPE can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CEBPE for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CEBPE, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.