Mouse anti-Human CEBPE Monoclonal Antibody | anti-CEBPE antibody

CEBPE (CCAAT/Enhancer-binding Protein epsilon, C/EBP epsilon) (FITC)

Cat. Num. AAA6146445

• Gene Names: CEBPE; CRP1; C/EBP-epsilon
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: CEBPE; Monoclonal Antibody; CEBPE (CCAAT/Enhancer-binding Protein epsilon; C/EBP epsilon) (FITC); anti-CEBPE antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 7A4
• Specificity: Recognizes human CEBPE.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

• Applicable Applications for anti-CEBPE antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant corresponding to aa1-281 from human CEBPE (AAH35797.2) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MSHGTYYECEPRGGQQPLEFSGGRAGPGELGDMCEHEASIDLSAYIESGEEQLLSDLFAVKPAPEARGLKGPGTPAFPHYLPPDPRPFAYPPHTFGPDRKALGPGIYSSPGSYDPRAVAVKEEPRGPEGSRAASRGSYNPLQYQVAHCGQTAMHLPPTLAAPGQPLRVLKAPLATAAPPCSPLLKAPSP AGPLHKGKKAVNKDSLEYRLRRERNNIAVRKSRDKAKRRILETQQKVLEYMAENERLRSRVEQLTQELDTLRNLFRQIPEAANLIKGVGGCS
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (56.65kD).)

Western Blot (WB)

(Western Blot analysis of CEBPE expression in transfected 293T cell line by CEBPE monoclonal antibody. Lane 1: CEBPE transfected lysate (30.6kD). Lane 2: Non-transfected lysate.)

Western Blot (WB)

(Western blot analysis of CEBPE over-expressed 293 cell line, cotransfected with CEBPE Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with CEBPE monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Related Product Information for anti-CEBPE antibody

CCAAT-enhancer binding protein epsilon (CEBP e) is a 32kD basic-leucine zipper transcription factor that is expressed in myeloblasts, granulocytes, and eosinophils. Multiple isoforms of human CEBP e are generated by alternate splicing and alternative translation initiation sites. All four isoforms contain the bZIP domain (aa208-267) but exert different effects on myeloid differentiation. Full length CEBP e and the 30kD isoform (aa33-281) cooperate with c-Myb to activate the transcription of genes involved in myeloid differentiation. The 27kD isoform (which lacks aa69-97) and the 14kD isoform (which begins at aa153) function as transcriptional repressors in eosinophils. Within aa151-210, human CEBP e shares 93aa sequence identity with mouse and rat CEBP e, respectively.

Product Categories/Family for anti-CEBPE antibody

Antibodies; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 23272762
• NCBI GeneID: 1053
• Molecular Weight: 30,603 Da
• NCBI Official Full Name: Homo sapiens CCAAT/enhancer binding protein (C/EBP), epsilon, mRNA
• NCBI Official Synonym Full Names: CCAAT/enhancer binding protein epsilon
• NCBI Official Symbol: CEBPE
• NCBI Official Synonym Symbols: CRP1; C/EBP-epsilon
• NCBI Protein Information: CCAAT/enhancer-binding protein epsilon
• Protein Family: CCAAT/enhancer-binding protein

NCBI Description

The protein encoded by this gene is a bZIP transcription factor which can bind as a homodimer to certain DNA regulatory regions. It can also form heterodimers with the related protein CEBP-delta. The encoded protein may be essential for terminal differentiation and functional maturation of committed granulocyte progenitor cells. Mutations in this gene have been associated with Specific Granule Deficiency, a rare congenital disorder. Multiple variants of this gene have been described, but the full-length nature of only one has been determined. [provided by RefSeq, Jul 2008]