Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human CDS2 Monoclonal Antibody | anti-CDS2 antibody

CDS2 (Phosphatidate Cytidylyltransferase 2, CDP-DAG Synthase 2, CDP-DG Synthase 2, CDP-diacylglycerol Synthase 2, CDS 2, CDP-diglyceride Pyrophosphorylase 2, CDP-diglyceride Synthase 2, CTP:Phosphatidate Cytidylyltransferase 2) (MaxLight 650)

Gene Names
ADAM9; MCMP; MDC9; CORD9; Mltng
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CDS2; Monoclonal Antibody; CDS2 (Phosphatidate Cytidylyltransferase 2; CDP-DAG Synthase 2; CDP-DG Synthase 2; CDP-diacylglycerol Synthase 2; CDS 2; CDP-diglyceride Pyrophosphorylase 2; CDP-diglyceride Synthase 2; CTP:Phosphatidate Cytidylyltransferase 2) (MaxLight 650); anti-CDS2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2B9
Specificity
Recognizes human CDS2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight650.
Sequence Length
819
Applicable Applications for anti-CDS2 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-68 from CDS2 (NP_003809) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MTELRQRVAHEPVAPPEDKESESEAKVDGETASDSESRAESAPLPVSADDTPEVLNRALSNLSSRWK
Conjugate
MaxLight650
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-CDS2 antibody
May act cooperatively with GRB10 to regulate tyrosine kinase receptor signaling. May increase IGF1 receptor phosphorylation under IGF1 stimulation as well as phosphorylation of IRS1 and SHC1 (By similarity).
Product Categories/Family for anti-CDS2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
disintegrin and metalloproteinase domain-containing protein 9
NCBI Official Synonym Full Names
ADAM metallopeptidase domain 9
NCBI Official Symbol
ADAM9
NCBI Official Synonym Symbols
MCMP; MDC9; CORD9; Mltng
NCBI Protein Information
disintegrin and metalloproteinase domain-containing protein 9
UniProt Protein Name
Disintegrin and metalloproteinase domain-containing protein 9
UniProt Gene Name
ADAM9
UniProt Synonym Gene Names
KIAA0021; MCMP; MDC9; MLTNG; ADAM 9
UniProt Entry Name
ADAM9_HUMAN

NCBI Description

This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. The protein encoded by this gene interacts with SH3 domain-containing proteins, binds mitotic arrest deficient 2 beta protein, and is also involved in TPA-induced ectodomain shedding of membrane-anchored heparin-binding EGF-like growth factor. Several alternatively spliced transcript variants have been identified for this gene. [provided by RefSeq, Jul 2010]

Uniprot Description

ADAM9: Probable zinc protease. May mediate cell-cell or cell- matrix interactions. Isoform 2 displays alpha-secretase activity for APP. Widely expressed. Expressed in chondrocytes. Isoform 2 is highly expressed in liver and heart. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Protease; Motility/polarity/chemotaxis; EC 3.4.24.-

Chromosomal Location of Human Ortholog: 8p11.22

Cellular Component: extracellular space; focal adhesion; cell surface; basolateral plasma membrane; cytoplasm; integral to membrane

Molecular Function: collagen binding; integrin binding; protein binding; protein kinase C binding; zinc ion binding; metallopeptidase activity; metalloendopeptidase activity; laminin binding; SH3 domain binding

Biological Process: integrin-mediated signaling pathway; positive regulation of keratinocyte migration; extracellular matrix organization and biogenesis; activation of MAPKK activity; cell-matrix adhesion; membrane protein ectodomain proteolysis; response to glucocorticoid stimulus; positive regulation of cell adhesion mediated by integrin; positive regulation of membrane protein ectodomain proteolysis; keratinocyte differentiation; response to manganese ion; collagen catabolic process; extracellular matrix disassembly; PMA-inducible membrane protein ectodomain proteolysis; monocyte activation; response to hydrogen peroxide; positive regulation of protein secretion; transforming growth factor beta receptor signaling pathway; cell-cell adhesion mediated by integrin; cell adhesion mediated by integrin; cell adhesion; response to calcium ion

Disease: Cone-rod Dystrophy 9

Research Articles on CDS2

Similar Products

Product Notes

The CDS2 adam9 (Catalog #AAA6221416) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CDS2 (Phosphatidate Cytidylyltransferase 2, CDP-DAG Synthase 2, CDP-DG Synthase 2, CDP-diacylglycerol Synthase 2, CDS 2, CDP-diglyceride Pyrophosphorylase 2, CDP-diglyceride Synthase 2, CTP:Phosphatidate Cytidylyltransferase 2) (MaxLight 650) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CDS2 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CDS2 adam9 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CDS2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.