Mouse anti-Human CDK5RAP3 Monoclonal Antibody | anti-CDK5RAP3 antibody

CDK5RAP3 (CDK5 Regulatory Subunit-associated Protein 3, CDK5 Activator-binding Protein C53, Protein HSF-27, IC53, MSTP016, OK/SW-cl.114, PP1553) (AP)

Cat. Num. AAA6130514

• Gene Names: CDK5RAP3; C53; IC53; LZAP; HSF-27; MST016; PP1553; OK/SW-cl.114
• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: CDK5RAP3; Monoclonal Antibody; CDK5RAP3 (CDK5 Regulatory Subunit-associated Protein 3; CDK5 Activator-binding Protein C53; Protein HSF-27; IC53; MSTP016; OK/SW-cl.114; PP1553) (AP); anti-CDK5RAP3 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 1G4
• Specificity: Recognizes human CDK5RAP3.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).

• Applicable Applications for anti-CDK5RAP3 antibody: ELISA (EIA), Immunohistochemistry (IHC), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant corresponding to aa1-507 from human CDK5RAP3 (AAH09957) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MEDHQHVPIDIQTSKLLDWLVDRRHCSLKWQSLVLTIREKINAAIQDMPESEEIAQLLSGSYIHYFHCLRILDLLKGTEASTKNIFGRYSSQRMKDWQEIIALYEKDNTYLVELSSLLVRNVNYEIPSLKKQIAKCQQLQQEYSRKEEECQAGAAEMREQFYHSCKQYGITGENVRGELLALVKDLPSQLAEIGAAAQQSLGEAIDVYQASVGFVCESPTEQVLPMLRFVQKRGNSTVYEWRTGTEPSVVERPHLEELPEQVAEDAIDWGDFGVEAVSEGTDSGISAEAAGIDWGIFPESDSKDPGGDGIDWGDDAVALQITVLEAGTQAPEGVARGPDALTLLEYTETRNQFLDELMELEIFLAQRAVELSEEADVLSVSQFQLAPAILQGQTKEKMVTMVSVLEDLIGKLTSLQLQHLFMILASPRYVDRVTEFLQQKLKQSQLLALKKELMVQKQQEALEEQAALEPKLDLLLEKTKELQKLIEADISKRYSGRPVNLMGTSL
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (81.77kD).)

Western Blot (WB)

(CDK5RAP3 monoclonal antibody, Western Blot analysis of CDK5RAP3 expression in A-431.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to CDK5RAP3 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3ug/ml].)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to CDK5RAP3 on HeLa cell. [antibody concentration 10ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged CDK5RAP3 is ~0.03ng/ml as a capture antibody.)

Product Categories/Family for anti-CDK5RAP3 antibody

Antibodies; Protein Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 39644876
• NCBI GeneID: 80279
• Molecular Weight: 59,589 Da
• NCBI Official Full Name: Homo sapiens CDK5 regulatory subunit associated protein 3, mRNA
• NCBI Official Synonym Full Names: CDK5 regulatory subunit associated protein 3
• NCBI Official Symbol: CDK5RAP3
• NCBI Official Synonym Symbols: C53; IC53; LZAP; HSF-27; MST016; PP1553; OK/SW-cl.114
• NCBI Protein Information: CDK5 regulatory subunit-associated protein 3
• Protein Family: CDK5RAP3-like protein

NCBI Description

This gene encodes a protein that has been reported to function in signaling pathways governing transcriptional regulation and cell cycle progression. It may play a role in tumorigenesis and metastasis. A pseudogene of this gene is located on the long arm of chromosome 20. Alternative splicing results in multiple transcript variants that encode different isoforms. [provided by RefSeq, May 2013]