Mouse anti-Human CDK3 Monoclonal Antibody | anti-CDK3 antibody

CDK3 (Cyclin-dependent Kinase 3, Cell Division Protein Kinase 3, CDKN3) (AP)

Cat. Num. AAA6130512

• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: CDK3; Monoclonal Antibody; CDK3 (Cyclin-dependent Kinase 3; Cell Division Protein Kinase 3; CDKN3) (AP); anti-CDK3 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 3C12
• Specificity: Recognizes human CDK3.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).

• Applicable Applications for anti-CDK3 antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
• Application Notes: IHC-P: 3ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa206-305 from human CDK3 (NP_001249) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: DSEIDQLFRIFRMLGTPSEDTWPGVTQLPDYKGSFPKWTRKGLEEIVPNLEPEGRDLLMQLLQYDPSQRITAKTALAHPYFSSPEPSPAARQYVLQRFRH
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.63kD).)

Western Blot (WB)

(Western Blot analysis of CDK3 expression in transfected 293T cell line by CDK3 monoclonal antibody. Lane 1: CDK3 transfected lysate (35kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to CDK3 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged CDK3 is ~0.1ng/ml as a capture antibody.)

Product Categories/Family for anti-CDK3 antibody

Antibodies; Protein Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 4557439
• NCBI GeneID: 1018
• NCBI Accession #: NP_001249
• NCBI GenBank Nucleotide #: NM_001258
• UniProt Accession #: Q00526
• Molecular Weight: 37.4kDa (328aa)
• NCBI Official Full Name: cyclin-dependent kinase 3
• NCBI Official Synonym Full Names: cyclin dependent kinase 3
• NCBI Official Symbol: CDK3
• NCBI Protein Information: cyclin-dependent kinase 3
• UniProt Protein Name: Cyclin-dependent kinase 3
• Protein Family: Cyclin-dependent kinase
• UniProt Gene Name: CDK3
• UniProt Synonym Gene Names: CDKN3
• UniProt Entry Name: CDK3_HUMAN

NCBI Description

This gene encodes a member of the cyclin-dependent protein kinase family. The protein promotes entry into S phase, in part by activating members of the E2F family of transcription factors. The protein also associates with cyclin C and phosphorylates the retinoblastoma 1 protein to promote exit from G0. [provided by RefSeq, Jul 2008]

Uniprot Description

CDK3: a protein kinase of the CDK family. May be involved in cell cycle control. Can phosphorylate histone H1.

Protein type: Protein kinase, CMGC; Cell cycle regulation; EC 2.7.11.22; Protein kinase, Ser/Thr (non-receptor); Kinase, protein; CMGC group; CDK family; CDK/CDK1 subfamily; CDK1 subfamily

Chromosomal Location of Human Ortholog: 17q25.1

Molecular Function: cyclin-dependent protein kinase activity; ATP binding

Biological Process: mitosis; cell proliferation; G0 to G1 transition; regulation of cell cycle; cell division; protein amino acid phosphorylation; G1/S transition of mitotic cell cycle