Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human CDC45L Monoclonal Antibody | anti-CDC45L antibody

CDC45L (Cell Division Control Protein 45 Homolog, PORC-PI-1, CDC45, CDC45L2, UNQ374/PRO710) (MaxLight 650)

Gene Names
CDC45; CDC45L; MGORS7; CDC45L2; PORC-PI-1
Reactivity
Human
Applications
Immunofluorescence, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CDC45L; Monoclonal Antibody; CDC45L (Cell Division Control Protein 45 Homolog; PORC-PI-1; CDC45; CDC45L2; UNQ374/PRO710) (MaxLight 650); anti-CDC45L antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
3F11-1F3
Specificity
Recognizes human CDC45L.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight650.
Applicable Applications for anti-CDC45L antibody
FLISA, Immunofluorescence (IF), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-567 from CDC45L (AAH06232) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MFVSDFRKEFYEVVQSQRVLLFVASDVDALCACKILQALFQCDHVQYTLVPVSGWQELETAFLEHKEQFHYFILINCGANVDLLDILQPDEDTIFFVCDTHRPVNVVNVYNDTQIKLLIKQDDDLEVPAYEDIFRDEEEDEEHSGNDSDGSEPSEKRTRLEEEIVEQTMRRRQRREWEARRRDILFDYEQYEYHGTSSAMVMFELAWMLSKDLNDMLWWAIVGLTDQWVQDKITQMKYVTDVGVLQRHVSRHNHR
Conjugate
MaxLight650
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Product Categories/Family for anti-CDC45L antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
68,768 Da
NCBI Official Full Name
Homo sapiens CDC45 cell division cycle 45-like (S. cerevisiae), mRNA
NCBI Official Synonym Full Names
cell division cycle 45
NCBI Official Symbol
CDC45
NCBI Official Synonym Symbols
CDC45L; MGORS7; CDC45L2; PORC-PI-1
NCBI Protein Information
cell division control protein 45 homolog
UniProt Protein Name
Cell division control protein 45 homolog
UniProt Gene Name
CDC45
UniProt Synonym Gene Names
CDC45L; CDC45L2
UniProt Entry Name
CDC45_HUMAN

NCBI Description

The protein encoded by this gene was identified by its strong similarity with Saccharomyces cerevisiae Cdc45, an essential protein required to the initiation of DNA replication. Cdc45 is a member of the highly conserved multiprotein complex including Cdc6/Cdc18, the minichromosome maintenance proteins (MCMs) and DNA polymerase, which is important for early steps of DNA replication in eukaryotes. This protein has been shown to interact with MCM7 and DNA polymerase alpha. Studies of the similar gene in Xenopus suggested that this protein play a pivotal role in the loading of DNA polymerase alpha onto chromatin. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013]

Uniprot Description

CDC45L: Required for initiation of chromosomal DNA replication. Associated with ORC2. Widely expressed, highest levels are found in adult testis and thymus and in fetal liver. Belongs to the CDC45 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Cell cycle regulation

Chromosomal Location of Human Ortholog: 22q11.21

Cellular Component: nucleoplasm; centrosome; cytoplasm; nucleus

Molecular Function: protein binding; 3'-5' DNA helicase activity; DNA replication origin binding; chromatin binding; single-stranded DNA binding

Biological Process: G1/S-specific transcription in mitotic cell cycle; DNA replication initiation; regulation of chromatin silencing at telomere; mitotic cell cycle; DNA strand elongation during DNA replication; DNA replication checkpoint; DNA replication; DNA duplex unwinding; double-strand break repair via break-induced replication; G1/S transition of mitotic cell cycle; pre-replicative complex assembly

Research Articles on CDC45L

Similar Products

Product Notes

The CDC45L cdc45 (Catalog #AAA6221392) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CDC45L (Cell Division Control Protein 45 Homolog, PORC-PI-1, CDC45, CDC45L2, UNQ374/PRO710) (MaxLight 650) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CDC45L can be used in a range of immunoassay formats including, but not limited to, FLISA, Immunofluorescence (IF), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CDC45L cdc45 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CDC45L, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.