Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (33.04kD).)

Mouse anti-Human CDC42EP4 Monoclonal Antibody | anti-CDC42EP4 antibody

CDC42EP4 (Cdc42 Effector Protein 4, Binder of Rho GTPases 4, BORG4, CEP4) (HRP)

Gene Names
CDC42EP4; CEP4; BORG4; KAIA1777
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CDC42EP4; Monoclonal Antibody; CDC42EP4 (Cdc42 Effector Protein 4; Binder of Rho GTPases 4; BORG4; CEP4) (HRP); anti-CDC42EP4 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
3G10
Specificity
Recognizes human CDC42EP4.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Sequence Length
3098
Applicable Applications for anti-CDC42EP4 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa163-226 from CDC42EP4 (NP_036253) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
VPRRNGAAGPHSPDPLLDEQAFGDLTDLPVVPKATYGLKHAESIMSFHIDLGPSMLGDVLSIM*
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (33.04kD).)

Western Blot (WB) (Western Blot detection against Immunogen (33.04kD).)
Related Product Information for anti-CDC42EP4 antibody
Probably involved in the organization of the actin cytoskeleton. May act downstream of CDC42 to induce actin filament assembly leading to cell shape changes. Induces pseudopodia formation, when overexpressed in fibroblasts.
Product Categories/Family for anti-CDC42EP4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens CDC42 effector protein 4 (CDC42EP4), mRNA
NCBI Official Synonym Full Names
CDC42 effector protein 4
NCBI Official Symbol
CDC42EP4
NCBI Official Synonym Symbols
CEP4; BORG4; KAIA1777
NCBI Protein Information
cdc42 effector protein 4
UniProt Protein Name
Cdc42 effector protein 4
Protein Family
UniProt Gene Name
CDC42EP4
UniProt Synonym Gene Names
BORG4; CEP4
UniProt Entry Name
BORG4_HUMAN

NCBI Description

The product of this gene is a member of the CDC42-binding protein family. Members of this family interact with Rho family GTPases and regulate the organization of the actin cytoskeleton. This protein has been shown to bind both CDC42 and TC10 GTPases in a GTP-dependent manner. When overexpressed in fibroblasts, this protein was able to induce pseudopodia formation, which suggested a role in inducing actin filament assembly and cell shape control. [provided by RefSeq, Jul 2008]

Uniprot Description

CDC42EP4: Probably involved in the organization of the actin cytoskeleton. May act downstream of CDC42 to induce actin filament assembly leading to cell shape changes. Induces pseudopodia formation, when overexpressed in fibroblasts. Belongs to the BORG/CEP family.

Protein type: Cytoskeletal

Chromosomal Location of Human Ortholog: 17q24-q25

Cellular Component: microtubule cytoskeleton; cytoplasm; plasma membrane; endomembrane system; actin cytoskeleton

Molecular Function: GTP-Rho binding

Biological Process: regulation of cell shape; positive regulation of pseudopodium formation; positive regulation of actin filament polymerization; Rho protein signal transduction

Research Articles on CDC42EP4

Similar Products

Product Notes

The CDC42EP4 cdc42ep4 (Catalog #AAA6151715) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CDC42EP4 (Cdc42 Effector Protein 4, Binder of Rho GTPases 4, BORG4, CEP4) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CDC42EP4 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CDC42EP4 cdc42ep4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CDC42EP4, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.