Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human CDC25A Monoclonal Antibody | anti-CDC25A antibody

CDC25A (M-phase Inducer Phosphatase 1, Dual Specificity Phosphatase Cdc25A) (MaxLight 405)

Gene Names
CDC25A; CDC25A2
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CDC25A; Monoclonal Antibody; CDC25A (M-phase Inducer Phosphatase 1; Dual Specificity Phosphatase Cdc25A) (MaxLight 405); anti-CDC25A antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3D5
Specificity
Recognizes human CDC25A.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight405.
Applicable Applications for anti-CDC25A antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa151-250 from human CDC25A (AAH07401) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PVRPVSRGCLHSHGLQEGKDLFTQRQNSAPARMLSSNERDSSEPGNFIPLFTPQSPVTATLSDEDDGFVDLLDGENLKNEEETPSCMASLWTAPLVMRTT
Conjugate
MaxLight405
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight405 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-CDC25A antibody
CDC25A, a CDC25 dual specificity protein phosphatase, has been shown to activate the cyclin-dependent kinases at different points of the cell cycle. CDC25A has been shown to affect S phase entry and possibly the initiation of mitosis. CDC25A dephosphorylates cyclin dependent kinases, including Cdk2, Cdk4, as well as non cyclin proteins such as the homeodomain transcription factor cut, the proto-oncogene Raf-1. CDC25A has been implicated in many carcinomas, including those of the colon, lymph node, stomach, ovary, breast. CDC25A is located on chromosome 3p21 in an area frequently involved in karyotypic abnormalities in renal carcinomas, small cell carcinomas of the lung, and benign tumors of the salivary gland.
Product Categories/Family for anti-CDC25A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
993
Molecular Weight
54,551 Da
NCBI Official Full Name
Homo sapiens cell division cycle 25 homolog A (S. pombe), mRNA
NCBI Official Synonym Full Names
cell division cycle 25A
NCBI Official Symbol
CDC25A
NCBI Official Synonym Symbols
CDC25A2
NCBI Protein Information
M-phase inducer phosphatase 1

NCBI Description

CDC25A is a member of the CDC25 family of phosphatases. CDC25A is required for progression from G1 to the S phase of the cell cycle. It activates the cyclin-dependent kinase CDC2 by removing two phosphate groups. CDC25A is specifically degraded in response to DNA damage, which prevents cells with chromosomal abnormalities from progressing through cell division. CDC25A is an oncogene, although its exact role in oncogenesis has not been demonstrated. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Research Articles on CDC25A

Similar Products

Product Notes

The CDC25A (Catalog #AAA6189355) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CDC25A (M-phase Inducer Phosphatase 1, Dual Specificity Phosphatase Cdc25A) (MaxLight 405) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CDC25A can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CDC25A for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CDC25A, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.