Mouse CDC2 Monoclonal Antibody | anti-CDC2 antibody

CDC2 (Cell Division Cycle 2, G1 to S and G2 to M, CDC28A, CDK1, DKFZp686L20222, MGC111195) (HRP)

Cat. Num. AAA6179180

• Gene Names: CDK1; CDC2; CDC28A; P34CDC2
• Applications: Immunohistochemistry, Western Blot
• Purity: Purified
• Synonyms: CDC2; Monoclonal Antibody; CDC2 (Cell Division Cycle 2; G1 to S and G2 to M; CDC28A; CDK1; DKFZp686L20222; MGC111195) (HRP); Cell Division Cycle 2; MGC111195; anti-CDC2 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 1C7
• Specificity: Recognizes CDC2.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
• Sequence Length: 297

• Applicable Applications for anti-CDC2 antibody: Immunohistochemistry (IHC), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: CDC2 (AAH14563, 211aa-297aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: DQLFRIFRALGTPNNEVWPEVESLQDYKNTFPKWKPGSLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHPYFNDLDNQIKKM
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Immunoperoxidase of monoclonal antibody to CDC2 on formalin-fixed paraffin-embedded human testis. [antibody concentration 0.5 ug/ml])

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to CDC2 on formalin-fixed paraffin-embedded human testis. [antibody concentration 0.5 ug/ml])

Western Blot (WB)

(CDC2 monoclonal antibody (M02), clone 1C7 Western Blot analysis of CDC2 expression in Jurkat (Cat # L017V1).)

Testing Data

(Detection limit for recombinant GST tagged CDC2 is approximately 0.03ng/ml as a capture antibody.)

Product Categories/Family for anti-CDC2 antibody

Antibodies; Cell Division Cycle (CDC)

NCBI and Uniprot Product Information

• NCBI GI #: 15778967
• NCBI GeneID: 983
• NCBI Official Full Name: Cell division cycle 2, G1 to S and G2 to M
• NCBI Official Synonym Full Names: cyclin dependent kinase 1
• NCBI Official Symbol: CDK1
• NCBI Official Synonym Symbols: CDC2; CDC28A; P34CDC2
• NCBI Protein Information: cyclin-dependent kinase 1
• Protein Family: CDC25-like phosphatase

NCBI Description

The protein encoded by this gene is a member of the Ser/Thr protein kinase family. This protein is a catalytic subunit of the highly conserved protein kinase complex known as M-phase promoting factor (MPF), which is essential for G1/S and G2/M phase transitions of eukaryotic cell cycle. Mitotic cyclins stably associate with this protein and function as regulatory subunits. The kinase activity of this protein is controlled by cyclin accumulation and destruction through the cell cycle. The phosphorylation and dephosphorylation of this protein also play important regulatory roles in cell cycle control. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2009]